KEGG   Bacillus subtilis subsp. subtilis 168: BSU23180
Entry
BSU23180          CDS       T00010                                 

Gene name
spmA
Definition
(RefSeq) spore maturation protein A
  KO
K06373  spore maturation protein A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU23180 (spmA)
SSDB
Motif
Pfam: Gate MFS_MOT1 DUF5453
Other DBs
NCBI-GeneID: 938954
NCBI-ProteinID: NP_390199
Pasteur: BG10528
BSORF: BG10528
UniProt: P35157 A0A6M3ZDY5
Position
complement(2422805..2423395)
AA seq 196 aa
MVNIIWVSLTVIGLVFAMCNGTLQDVNEAVFKGAKEAITISFGLMSVLVFWLGLMKIAEQ
SGLLDIFSRMCRPFISKLFPDIPPDHPAMGYILSNLMANFFGLGNAATPLGIKAMEQMKK
LNGNRSEASRSMITFLAVNTSCITLIPTTVIAVRMAYSSKTPTDIVGPSILATLISGIGA
IIIDRYFYYRRKKKGR
NT seq 591 nt   +upstreamnt  +downstreamnt
atggtcaatataatttgggtcagtttaaccgtgatcggactcgtttttgcgatgtgcaac
ggaactctgcaagatgtaaatgaagccgtgtttaagggtgcgaaagaagcgattacgatc
tcatttggattgatgagcgtgcttgttttctggcttggcttaatgaaaatcgccgagcag
tcagggcttttggatattttcagccggatgtgcagaccttttatatctaaactgttccct
gatataccgccggatcacccggcgatgggctatattttatctaatcttatggcgaatttc
ttcggcctcggaaatgcagcaactccgcttggcattaaagcaatggaacaaatgaaaaag
ctgaacggaaaccgatcggaagcaagccggtcgatgattacttttttagctgttaatacg
tcctgcatcacactcatcccgacaacggtgatcgctgtccgaatggcttattcctccaaa
acgccgacagatatcgtcgggccaagcattttggcaacgcttatttccggaatcggtgcc
attatcattgatcggtatttttattaccgccgcaaaaagaagggaaggtga

DBGET integrated database retrieval system