KEGG   Bacillus subtilis subsp. subtilis 168: BSU23190
Entry
BSU23190          CDS       T00010                                 

Symbol
dacB
Name
(RefSeq) D-alanyl-D-alanine carboxypeptidase DacB
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00550  Peptidoglycan biosynthesis
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU23190 (dacB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU23190 (dacB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU23190 (dacB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BSU23190 (dacB)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BSU23190 (dacB)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BSU23190 (dacB)
SSDB
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Other DBs
NCBI-GeneID: 938953
NCBI-ProteinID: NP_390200
Pasteur: BG10527
BSORF: BG10527
UniProt: P35150 A0A6M3ZDD9
Structure
PDB: 
3MFD

Position
complement(2423383..2424531)
AA seq 382 aa
MRIFKKAVFVIMISFLIATVNVNTAHAAIDVSAKSAIIIDGASGRVLYAKDEHQKRRIAS
ITKIMTAVLAIESGKMDQTVTVSANAVRTEGSAIYLTEGQKVKLKDLVYGLMLRSGNDAA
VAIAEHVGGSLDGFVYMMNQKAEQLGMKNTRFQNPHGLDDHENHYSTAYDMAILTKYAMK
LKDYQKISGTKIYKAETMESVWKNKNKLLTMLYPYSTGGKTGYTKLAKRTLVSTASKDGI
DLIAVTINDPNDWDDHMKMFNYVFEHYQTYLIAKKGDIPKLKGTFYESKAFIKRDITYLL
TEEEKENVKINTTLLKPKKAWEKDASKIPDIVGHMEIMFNDATIAKVPIYYENERHQKPK
KQFFETFKSIFLNAAGGAKWSI
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgcgcattttcaaaaaagcagtattcgtgatcatgatttcttttcttattgcaaccgta
aatgtgaatacagcacatgctgctatagatgtcagtgcaaaaagcgcgatcattattgac
ggtgcgtcaggcagagtgttatatgccaaggatgagcatcaaaaaaggcggatcgcgagc
atcacaaaaattatgaccgccgtcctcgccatcgaatccggcaaaatggatcaaacagtg
acggtttcggcaaatgctgtcagaacagaaggctccgccatttatttaacagaaggtcaa
aaagtgaagctgaaagatcttgtgtatggcctgatgctaagatcaggaaacgatgccgct
gtcgcgattgctgagcatgtcggtgggagcctcgatgggtttgtttatatgatgaatcaa
aaagccgagcagcttggtatgaaaaacacccgttttcaaaacccgcacggattggacgac
catgaaaatcattattcaacagcctatgacatggccattttaactaagtatgctatgaag
ctgaaagactatcaaaagatttcaggcacaaaaatatacaaagcggaaacgatggaaagc
gtatggaaaaacaaaaacaaactgctgaccatgctttatccgtacagcacaggaggaaaa
acaggctatacaaaacttgcaaaacggacactggtctctacggcttcaaaggacggcatt
gacctgatagccgtcaccattaatgaccctaatgattgggatgaccatatgaagatgttt
aactatgtgtttgagcattatcaaacctatttaattgcaaaaaaaggggatattccaaag
ctgaaaggcacattttatgaatcgaaggcttttatcaaacgtgatatcacctatttgctg
accgaagaggaaaaagaaaatgtaaaaattaataccacactgctcaagccgaaaaaagca
tgggaaaaagatgcctcgaaaatccctgacatcgtagggcacatggagatcatgttcaac
gatgcaaccatcgcaaaagtgccgatctattatgaaaatgagcggcatcaaaaaccgaag
aaacaattttttgaaacgtttaaatcaatctttctgaatgcggcaggcggagcaaaatgg
tcaatataa

DBGET integrated database retrieval system