KEGG   Bacillus subtilis subsp. subtilis 168: BSU23200
Entry
BSU23200          CDS       T00010                                 

Gene name
ypuI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3907
Other DBs
NCBI-GeneID: 938956
NCBI-ProteinID: NP_390201
Pasteur: BG10526
BSORF: BG10526
UniProt: P35156 A0A6M4JNL3
Position
complement(2424654..2425193)
AA seq 179 aa
MKEAKCERQIHEGKIPNEMGHSIVRAQTQKTGEFLSMVVNTVNDYLNQTTLESLQAELPI
EKGYCCDVLSTLRRMAVFCEGGAEACRRLLMQEPFQEARAEKTLYNVYHQCIEEFFMPKK
DTWCENSRASYTGVSAIEFYHAVPASLEQLLLPLSAAFLKMREELAHYEASGSSMAPIR
NT seq 540 nt   +upstreamnt  +downstreamnt
atgaaagaagcaaaatgtgagagacaaatacatgaggggaagataccaaacgaaatggga
cattcgattgtgcgagcgcagactcaaaaaacaggcgaattcttatcaatggttgtcaat
accgtgaacgattacctaaatcaaacgacgcttgagtccttacaggctgaattgcctatt
gaaaaaggatactgctgtgatgtgcttagcactctgagaagaatggcagtattttgtgaa
ggaggcgcagaagcgtgccgtcgtctcctgatgcaggagccttttcaggaagccagagcg
gaaaaaacactttataatgtgtatcaccaatgcattgaagagttctttatgccgaaaaaa
gacacgtggtgtgaaaatagccgggcgtcttataccggggtcagcgcaattgagttttat
catgctgttcctgcgtcgcttgagcaattattattgccgttgagcgcggcctttctgaag
atgagggaagagctggctcattacgaagcgtccggatcaagcatggcgccaatcagataa

DBGET integrated database retrieval system