KEGG   Bacillus subtilis subsp. subtilis 168: BSU23210
Entry
BSU23210          CDS       T00010                                 

Gene name
spcB
Definition
(RefSeq) segregation and condensation protein B
  KO
K06024  segregation and condensation protein B
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU23210 (spcB)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    BSU23210 (spcB)
SSDB
Motif
Pfam: SMC_ScpB
Other DBs
NCBI-GeneID: 938951
NCBI-ProteinID: NP_390202
Pasteur: BG10525
BSORF: BG10525
UniProt: P35155
Position
complement(2425248..2425841)
AA seq 197 aa
MGLDIVNWKAIVEALLYAAGDEGLTKKQLLTVLEIEEPELNTIMADVADEYRGDTRGIEL
IEYADTYMLSTKKDFAPYLKKLIEVPSKGLSQASLEVLAIVSYKQPITRAEIEEIRGVKS
ERILHSLVAKALLCEVGRADGPGRAILYGTTPTFLEQFGLKTLDELPPLPENAEEDVLQE
EADLFFENFNQTFEDIK
NT seq 594 nt   +upstreamnt  +downstreamnt
atggggcttgatatcgtgaattggaaagctattgtggaagcccttctttatgcggcaggc
gatgaagggcttacaaaaaagcagctgttaacagtgcttgaaatcgaagagcctgaactg
aacacgatcatggcggatgtggcggacgaataccgcggagatacacgagggattgaactt
attgagtatgcagatacgtacatgctctctaccaaaaaagactttgcgccttacttgaaa
aaactgattgaagtgccgtcaaagggcctttctcaagcatctttagaagtactggccatt
gtttcatacaaacagccaattacgagagcagaaattgaagaaatcagaggagtaaaatca
gagcggattttacacagtcttgtcgcgaaggcgctattgtgtgaagtagggcgtgccgat
ggtccggggcgggccattttatacggtactacgccgacttttcttgaacaattcggtctg
aaaacgctggacgagcttccgccgctgcctgaaaatgcggaagaagacgttcttcaagaa
gaagcagatttattttttgaaaactttaaccaaaccttcgaagatataaaatag

DBGET integrated database retrieval system