KEGG   Bacillus subtilis subsp. subtilis 168: BSU23220
Entry
BSU23220          CDS       T00010                                 

Gene name
scpA
Definition
(RefSeq) segregation and condensation protein A
  KO
K05896  segregation and condensation protein A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU23220 (scpA)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    BSU23220 (scpA)
SSDB
Motif
Pfam: SMC_ScpA Rad21_Rec8 HAD_2 DUF3016 Troponin
Other DBs
NCBI-GeneID: 938950
NCBI-ProteinID: NP_390203
Pasteur: BG10524
BSORF: BG10524
UniProt: P35154 A0A6M3ZIU5
Structure
PDB: 
5H66 5H67 3ZGX 5XG3

Position
complement(2425831..2426586)
AA seq 251 aa
MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL
VMAATLLSIKSRMLLPKQEEELFEDELLEEEDPREELIEKLIEYRKYKDAAKDLKEREEE
RQKSFTKPPSDLSEYAKEVKQSEQKLSVTVYDMIGAFQKVLKRKKINRPMETTITRQDIP
IEARMNEIVHSLKSRGTRINFMDLFPYEQKEHLVVTFLAVLELMKNQLVLIEQEHNFSDI
YITGSESIHGA
NT seq 756 nt   +upstreamnt  +downstreamnt
atggaagaatatcaagtgaaaattgatacgtttgagggcccattggacctgctgcttcat
ttaatcaatcgtcttgaaattgacatatatgatatacctgtggcgaagatcactgaacaa
tatttattatatgtacatacgatgcgcgtgcttgagctcgacattgccagcgagtatttg
gttatggctgccacgctgctcagcattaaaagcagaatgctgctcccgaagcaagaggag
gagctttttgaagatgaattacttgaagaagaagatccgcgggaggaactgattgaaaag
ctgattgagtaccgaaaatataaagatgcggcgaaggatttaaaagaacgggaagaagaa
agacaaaaatcgttcacgaaaccgccgagtgatttgagtgaatatgcaaaagaagtaaaa
cagtctgagcaaaagctctctgtcacggtctatgatatgatcggagcttttcaaaaagtg
ctgaaacgcaaaaaaataaacaggccgatggaaacaacaattacaagacaggacatacca
atcgaagccagaatgaacgaaatcgtgcacagcttgaaatctagaggaacgagaattaac
tttatggatctgtttccatatgagcaaaaagaacatttagtagtgacctttctagctgtt
cttgagctgatgaaaaatcagctggtcctcattgaacaggagcacaatttttcagatatt
tacattacggggagtgaatccattcatggggcttga

DBGET integrated database retrieval system