KEGG   Bacillus subtilis subsp. subtilis 168: BSU23230
Entry
BSU23230          CDS       T00010                                 

Symbol
ypuF
Name
(RefSeq) hypothetical protein
  KO
K09763  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU23230 (ypuF)
SSDB
Motif
Pfam: DUF309
Other DBs
NCBI-GeneID: 938952
NCBI-ProteinID: NP_390204
Pasteur: BG10523
BSORF: BG10523
UniProt: P17617 A0A6M4JIQ5
Position
2426867..2427391
AA seq 174 aa
MYPKAYIDYLVEFHATRDYFECHEILEEYWKEDPPKKRKRYWVGFIQLAVALYHHRRQNT
AGAKRLMANSIRILQAEHRAVEDLGLDHGRLLELMQSVYEQIETVSAYKSIILPIKDEKL
EEACRIECRKKKYTWGQPSALSNIFLIDKHRLRDRTDVIREREKEIERRKKSRD
NT seq 525 nt   +upstreamnt  +downstreamnt
ttgtatccgaaagcttatatagattatctcgttgagtttcatgcgacacgggattatttt
gaatgccatgaaatattagaagaatattggaaggaagatccgccaaagaaacgaaaacgc
tattgggtgggctttattcagcttgcagtggctttatatcatcacagaaggcagaataca
gccggggcaaaaagactgatggcgaacagcatccggattcttcaagcagaacaccgggca
gtcgaagacttagggcttgatcatggccgtttgctcgaacttatgcaatcggtttacgaa
caaatcgaaaccgtctctgcctataaaagcattatactgccaatcaaagatgagaaactg
gaggaagcatgcaggatcgaatgcaggaaaaaaaagtatacatgggggcagcccagtgca
ctcagcaacatatttcttatcgacaaacaccgtttgcgggatcggactgacgtcatccgt
gaacgtgaaaaagaaatagaacgcagaaaaaaaagcagagactga

DBGET integrated database retrieval system