KEGG   Bacillus subtilis subsp. subtilis 168: BSU23250
Entry
BSU23250          CDS       T00010                                 

Gene name
ribH
Definition
(RefSeq) 6,7-dimethyl-8-ribityllumazine synthase
  KO
K00794  6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00740  Riboflavin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSU23250 (ribH)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.78  6,7-dimethyl-8-ribityllumazine synthase
     BSU23250 (ribH)
SSDB
Motif
Pfam: DMRL_synthase AIRS
Other DBs
NCBI-GeneID: 938949
NCBI-ProteinID: NP_390206
Pasteur: BG10521
BSORF: BG10521
UniProt: P11998 A0A6M3ZDG1
Structure
PDB: 
1RVV 1ZIS

Position
complement(2427892..2428356)
AA seq 154 aa
MNIIQGNLVGTGLKIGIVVGRFNDFITSKLLSGAEDALLRHGVDTNDIDVAWVPGAFEIP
FAAKKMAETKKYDAIITLGTVIRGATTHYDYVCNEAAKGIAQAANTTGVPVIFGIVTTEN
IEQAIERAGTKAGNKGVDCAVSAIEMANLNRSFE
NT seq 465 nt   +upstreamnt  +downstreamnt
atgaatatcatacaaggaaatttagttggtacaggtcttaaaatcggaatcgtagtagga
agatttaatgattttattacgagcaagctgctgagcggagcagaagatgcgctgctcaga
catggcgtagacacaaatgacattgatgtggcttgggttccaggcgcatttgaaataccg
tttgctgcgaaaaaaatggcggaaacaaaaaaatatgatgctattatcacattgggcact
gtcatcagaggcgcaacgacacattacgattatgtctgcaatgaagctgcaaaaggcatc
gcgcaagcagcaaacactactggtgtacctgtcatctttggaattgtaacaactgaaaac
atcgaacaggctatcgagcgtgccggcacaaaagcgggcaacaaaggtgtagattgtgct
gtttctgccattgaaatggcaaatttaaaccgctcatttgaataa

DBGET integrated database retrieval system