KEGG   Bacillus subtilis subsp. subtilis 168: BSU23300
Entry
BSU23300          CDS       T00010                                 

Symbol
ypuD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: baeRF_family7 DUF2206 DUF5412
Other DBs
NCBI-GeneID: 938943
NCBI-ProteinID: NP_390211
Pasteur: BG10516
BSORF: BG10516
UniProt: P17616 A0A6M3ZDZ3
Position
complement(2431737..2432081)
AA seq 114 aa
MGRIKTKITILLVLLLLLAGGYMYINDIELKDVPTAIGQTLSSEEEEYTIQEYKVTKIDG
SEYHGVAENGTKIIFNGKKLNQDLSDIKEGDKIKAYFSKSKRIDGLIKVAKVND
NT seq 345 nt   +upstreamnt  +downstreamnt
atgggaagaataaaaaccaagattaccattctgttagtgcttttgcttttacttgcaggc
ggttatatgtacataaatgatattgagctgaaggatgttccgacagcaattggacaaacc
ttgtcctcggaagaagaggaatacaccatccaggaatataaagtgacgaaaattgacggc
tcagagtatcatggagtagcagaaaacggaacgaaaatcatcttcaacggaaaaaaatta
aatcaggatttatctgatataaaagaaggtgacaagattaaggcttacttcagcaaatca
aagcggatcgacggattaatcaaggttgcaaaagtgaatgattaa

DBGET integrated database retrieval system