KEGG   Bacillus subtilis subsp. subtilis 168: BSU23300Help
Entry
BSU23300          CDS       T00010                                 

Gene name
ypuD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: baeRF_family7 DUF5412
Motif
Other DBs
NCBI-GeneID: 938943
NCBI-ProteinID: NP_390211
Pasteur: BG10516
BSORF: BG10516
UniProt: P17616
Position
complement(2431737..2432081)
Genome map
AA seq 114 aa AA seqDB search
MGRIKTKITILLVLLLLLAGGYMYINDIELKDVPTAIGQTLSSEEEEYTIQEYKVTKIDG
SEYHGVAENGTKIIFNGKKLNQDLSDIKEGDKIKAYFSKSKRIDGLIKVAKVND
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgggaagaataaaaaccaagattaccattctgttagtgcttttgcttttacttgcaggc
ggttatatgtacataaatgatattgagctgaaggatgttccgacagcaattggacaaacc
ttgtcctcggaagaagaggaatacaccatccaggaatataaagtgacgaaaattgacggc
tcagagtatcatggagtagcagaaaacggaacgaaaatcatcttcaacggaaaaaaatta
aatcaggatttatctgatataaaagaaggtgacaagattaaggcttacttcagcaaatca
aagcggatcgacggattaatcaaggttgcaaaagtgaatgattaa

DBGET integrated database retrieval system