KEGG   Bacillus subtilis subsp. subtilis 168: BSU23310
Entry
BSU23310          CDS       T00010                                 

Symbol
sipS
Name
(RefSeq) signal peptidase I S
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03060  Protein export
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU23310 (sipS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU23310 (sipS)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     BSU23310 (sipS)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S26: signal peptidase I family
   BSU23310 (sipS)
SSDB
Motif
Pfam: Peptidase_S26 Peptidase_S24
Other DBs
NCBI-GeneID: 938944
NCBI-ProteinID: NP_390212
Pasteur: BG10515
BSORF: BG10515
UniProt: P28628 A0A6M4JNL5
Position
complement(2432316..2432870)
AA seq 184 aa
MKSENVSKKKSILEWAKAIVIAVVLALLIRNFIFAPYVVDGDSMYPTLHNRERVFVNMTV
KYIGEFDRGDIVVLNGDDVHYVKRIIGLPGDTVEMKNDQLYINGKKVDEPYLAANKKRAK
QDGFDHLTDDFGPVKVPDNKYFVMGDNRRNSMDSRNGLGLFTKKQIAGTSKFVFYPFNEM
RKTN
NT seq 555 nt   +upstreamnt  +downstreamnt
ttgaaatcagaaaatgtttcgaagaaaaagtcaatattagaatgggcaaaagcaattgtg
attgctgtcgttcttgctttgctcatccgcaactttatttttgcgccgtatgtcgttgat
ggtgactctatgtatcctacacttcacaaccgtgaaagggtttttgttaatatgacagtc
aaatacatcggcgagtttgatagaggagacatcgtcgtgttaaacggagatgatgttcac
tatgtcaaacgtattatcggccttcccggcgatacggttgagatgaaaaatgaccagctc
tatatcaacgggaaaaaggtggacgaaccttatttggcggctaataaaaagagagcgaaa
caggacggttttgaccatttgaccgatgatttcggcccggttaaagtgcctgataacaag
tattttgtgatgggtgacaatcgtcgcaattccatggacagccgtaacggccttggcctc
ttcacgaaaaaacaaattgcgggtacgtcaaagtttgttttctacccgtttaacgaaatg
cgcaaaacaaattag

DBGET integrated database retrieval system