KEGG   Bacillus subtilis subsp. subtilis 168: BSU23320
Entry
BSU23320          CDS       T00010                                 

Symbol
ypzC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938940
NCBI-ProteinID: NP_390213
Pasteur: BG13765
BSORF: BG13765
UniProt: O32012 A0A6M4JNC8
Position
2433137..2433373
AA seq 78 aa
MFIYCIPLISQSMIPMALDKTINVMKVTGMFAATYFTGDNRTPFFAFIICLKSFKLENMD
QPPKNKSNIFPAVEDSLL
NT seq 237 nt   +upstreamnt  +downstreamnt
ttgttcatttactgcattccattgatctcccagtccatgatacccatggcacttgacaaa
acaattaacgtcatgaaggttactggaatgtttgcggcaacctatttcacaggtgataac
cgcaccccgttttttgctttcataatatgtttaaaatcattcaagctcgaaaacatggat
cagcctccaaaaaataaatccaatatattcccggcagttgaagactctttattataa

DBGET integrated database retrieval system