KEGG   Bacillus subtilis subsp. subtilis 168: BSU23328
Entry
BSU23328          CDS       T00010                                 

Symbol
ypzJ
Name
(RefSeq) hypothetical protein
  KO
K07069  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU23328 (ypzJ)
SSDB
Motif
Pfam: zinc_ribbon_13 DUF35_N Lar_restr_allev
Other DBs
NCBI-GeneID: 8302956
NCBI-ProteinID: YP_003097757
UniProt: C0H447 A0A6M3ZDU0
Position
complement(2433316..2433522)
AA seq 68 aa
MNNKGCIKCGSTEAGQKEIATTGTGLSKLFDVQHNRFLVVYCKNCGYSEFYNKESSTAGN
ILDLFFGG
NT seq 207 nt   +upstreamnt  +downstreamnt
atgaacaacaaaggctgtataaaatgcggtagtactgaagccggacaaaaagaaatagct
acaaccggcacgggattatcaaagctgtttgacgtgcagcataaccgatttctagtggtt
tactgtaagaactgcggatattcagagttttataataaagagtcttcaactgccgggaat
atattggatttattttttggaggctga

DBGET integrated database retrieval system