KEGG   Bacillus subtilis subsp. subtilis 168: BSU23340
Entry
BSU23340          CDS       T00010                                 

Symbol
ypuB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938942
NCBI-ProteinID: NP_390215
Pasteur: BG10513
BSORF: BG10513
UniProt: P35151 A0A6M3ZDA7
Position
complement(2434143..2434346)
AA seq 67 aa
MQVLTGLLEQYGYAVLFIVLMLELLALLGPGEFAGVLVFQEKLNWVLSMLAAGLGSCGSE
HVVLDRV
NT seq 204 nt   +upstreamnt  +downstreamnt
atgcaagttttgacggggttgctcgaacagtacggatatgccgtcttgtttattgtcttg
atgttagagcttctagctttacttggaccgggagagtttgccggtgttctcgtgtttcaa
gaaaagttaaactgggtgctaagcatgttagcggccggattggggagctgtgggagtgag
catgtcgtattggatcgggtatag

DBGET integrated database retrieval system