KEGG   Bacillus subtilis subsp. subtilis 168: BSU23350
Entry
BSU23350          CDS       T00010                                 

Gene name
ypzD
Definition
(RefSeq) spore germination protein-like protein YpzD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: gerPA
Other DBs
NCBI-GeneID: 938937
NCBI-ProteinID: NP_390216
Pasteur: BG13766
BSORF: BG13766
UniProt: O32013 A0A6M3ZDA2
Position
2435012..2435224
AA seq 70 aa
MIDYPININNVSGNSVINVGGAFMIRPLTLSKSVFGSGGLNTGIVFENNFVSKAKMINHQ
FTDQNVTKTF
NT seq 213 nt   +upstreamnt  +downstreamnt
atgattgattatcctattaatataaacaacgtttccgggaacagtgtaattaacgtaggc
ggcgcttttatgatcaggcctttaactttgtccaaatctgtgtttggctccggaggttta
aacacaggaattgtctttgaaaataactttgtaagcaaagctaaaatgattaatcatcaa
tttactgatcaaaacgtcaccaaaactttttaa

DBGET integrated database retrieval system