KEGG   Bacillus subtilis subsp. subtilis 168: BSU23360
Entry
BSU23360          CDS       T00010                                 

Symbol
ppiB
Name
(RefSeq) peptidyl-prolyl cis-trans isomerase
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU23360 (ppiB)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     BSU23360 (ppiB)
Chaperones and folding catalysts [BR:bsu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    BSU23360 (ppiB)
SSDB
Motif
Pfam: Pro_isomerase
Other DBs
NCBI-GeneID: 938934
NCBI-ProteinID: NP_390217
Pasteur: BG10512
BSORF: BG10512
UniProt: P35137 A0A6M3ZDH2
Position
complement(2435360..2435791)
AA seq 143 aa
MKTGYFLLEDGNKIEFELYPEAAPGTVANFEKLANEGFYDGLTFHRVIPGFVSQGGCPHG
TGTGGPGYTIKCETEGNPHTHEAGALSMAHAGKDTGGSQFFIVHEPQPHLNGVHTVFGKV
TSGLEFAKNMSNGDVMKEVRVEG
NT seq 432 nt   +upstreamnt  +downstreamnt
ttgaaaacaggttactttttattagaagacgggaacaaaattgaatttgaactttatcct
gaagctgcacctggaactgttgcaaactttgaaaagcttgcgaacgaaggcttttatgac
gggcttacattccaccgagtgatccctggcttcgtcagccaaggcggatgcccgcacgga
actggtacaggcggtccgggatacacaatcaaatgtgaaacagaaggcaacccgcataca
catgaggcgggcgcactttctatggcacatgccggaaaagacactggcggcagccaattt
ttcatcgttcatgagccacagcctcatttgaacggtgttcacactgtatttggtaaagta
acaagcggattagaattcgcgaaaaacatgtctaatggcgatgtcatgaaagaagttcgt
gtagaaggctaa

DBGET integrated database retrieval system