KEGG   Bacillus subtilis subsp. subtilis 168: BSU23370
Entry
BSU23370          CDS       T00010                                 

Symbol
ypuA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1002 DUF445 Cas9_a Maf_flag10_N HSP9_HSP12 DUF2789
Other DBs
NCBI-GeneID: 938939
NCBI-ProteinID: NP_390218
Pasteur: BG10511
BSORF: BG10511
UniProt: P31847 A0A6M4JL05
Position
2436045..2436917
AA seq 290 aa
MKKIWIGMLAAAVLLLMVPKVSLADAAVGDVIVTLGADLSESDKQKVLDEMNVPDNATTV
TVTNKEEHEYLGKYISNAQIGSRAISSSSITIAKKGSGLNVETHNISGITDEMYLNALMT
AGVKDAKVYVTAPFEVSGTAALTGLIKAYEVSSDEAISEDVKQVANQELVTTSELGDKIG
NENAAALIAKIKEEFAKNGVPDNKADIEKQVDDAASDLNVTLTDSQKNQLVSLFNKMKNA
DIDWGQVSDQLDKAKDKITKFIESDEGKNFIQKVIDFFVSIWNAIVSIFK
NT seq 873 nt   +upstreamnt  +downstreamnt
ttgaagaaaatttggattggaatgctggcagcggccgttttgctgctgatggttccgaag
gtcagtctcgcggatgccgcagttggagatgtcattgtaacactgggtgctgatttgtca
gaatctgacaaacaaaaagtgcttgatgaaatgaatgtccctgataatgccacaacggta
accgtgaccaataaggaagaacatgaatatttaggaaaatatatatcgaacgcgcaaatc
ggatcgagagcgatttcttcatcgtcaatcaccattgccaaaaaaggctccggattgaat
gttgagacccataatatcagcggcatcacagatgaaatgtacctgaatgcactgatgaca
gccggtgttaaagatgcgaaggtgtatgttacagcaccgtttgaagtatccgggactgcc
gctttaactggattgattaaggcgtatgaagtttcttctgacgaagcgatctcggaggat
gttaagcaggtcgccaaccaagagcttgtcacgacatcagagcttggagacaaaatcggt
aacgaaaatgcggcagccctgattgcaaaaatcaaagaagagtttgctaaaaacggggtg
cctgataataaagctgacatcgaaaaacaagtggatgacgcagcttctgatttaaacgtc
acacttacagacagccaaaagaatcagcttgtctccctattcaataagatgaaaaacgct
gacattgactggggacaggtcagtgaccagctagataaagcgaaagataagattacgaaa
ttcatagaatcagatgaaggcaaaaacttcatccagaaagtcattgatttcttcgtatct
atctggaatgcgattgtatctatattcaaataa

DBGET integrated database retrieval system