KEGG   Bacillus subtilis subsp. subtilis 168: BSU23380
Entry
BSU23380          CDS       T00010                                 

Symbol
lysA
Name
(RefSeq) diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00300  Lysine biosynthesis
bsu00470  D-Amino acid metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01230  Biosynthesis of amino acids
Module
bsu_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BSU23380 (lysA)
  09106 Metabolism of other amino acids
   00470 D-Amino acid metabolism
    BSU23380 (lysA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     BSU23380 (lysA)
SSDB
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC Ala_racemase_N
Other DBs
NCBI-GeneID: 938931
NCBI-ProteinID: NP_390219
Pasteur: BG10510
BSORF: BG10510
UniProt: P23630 A0A6M3ZIN2
Position
complement(2436947..2438266)
AA seq 439 aa
MFLHGTSRQNQHGHLEIGGVDALYLAEKYGTPLYVYDVALIRERAKSFKQAFISAGLKAQ
VAYASKAFSSVAMIQLAEEEGLSLDVVSGGELYTAVAAGFPAERIHFHGNNKSREELRMA
LEHRIGCIVVDNFYEIALLEDLCKETGHSIDVLLRITPGVEAHTHDYITTGQEDSKFGFD
LHNGQTERAIEQVLQSEHIQLLGVHCHIGSQIFDTAGFVLAAEKIFKKLDEWRDSYSFVS
KVLNLGGGFGIRYTEDDEPLHATEYVEKIIEAVKENASRYGFDIPEIWIEPGRSLVGDAG
TTLYTVGSQKEVPGVRQYVAVDGGMNDNIRPALYQAKYEAAAANRIGEAHDKTVSIAGKC
CESGDMLIWDIDLPEVKEGDLLAVFCTGAYGYSMANNYNRIPRPAVVFVENGEAHLVVKR
ETYEDIVKLDLPFKTGVKQ
NT seq 1320 nt   +upstreamnt  +downstreamnt
ttgttcttacacggcacaagcagacaaaatcaacatggtcatttagaaatcggaggtgtg
gatgctctctatttagcggagaaatatggtacacctctttacgtatatgatgtggcttta
atacgtgagcgtgctaaaagctttaagcaggcgtttatttctgcagggctgaaagcacag
gtggcatatgcgagcaaagcattctcatcagtcgcaatgattcagctcgctgaggaagag
ggactttctttagatgtcgtatccggaggagagctatatacggctgttgcagcaggcttt
ccggcagaacgcatccactttcatggaaacaataagagcagggaagaactgcggatggcg
cttgagcaccgcatcggctgcattgtggtggataatttctatgaaatcgcgcttcttgaa
gacctatgtaaagaaacgggtcactccatcgatgttcttcttcggatcacgcccggagta
gaagcgcatacgcatgactacattacaacgggccaggaagattcaaagtttggtttcgat
cttcataacggacaaactgaacgggccattgaacaagtattacaatcggaacacattcag
ctgctgggtgtccattgccatatcggctcgcaaatctttgatacggccggttttgtgtta
gcagcggaaaaaatcttcaaaaaactagacgaatggagagattcatattcatttgtatcc
aaggtgctgaatcttggaggaggtttcggcattcgttatacggaagatgatgaaccgctt
catgccactgaatacgttgaaaaaattatcgaagctgtgaaagaaaatgcttcccgttac
ggttttgacattccggaaatttggatcgaaccgggccgttctctcgtgggagacgcaggc
acaactctttatacggttggctctcaaaaagaagtgccgggtgtccgccaatatgtggct
gtagacggaggcatgaacgacaatattcgtcctgcgctttaccaagctaaatatgaagct
gcggcagccaacaggatcggagaagcgcatgacaaaacggtatcaattgccggaaagtgc
tgtgaaagcggagatatgctgatttgggatattgacctgccggaagtaaaagaaggcgat
cttcttgccgttttttgtacaggcgcttatggatacagcatggccaacaattataaccgt
attccgagacccgccgttgtatttgtcgaaaacggtgaggctcatttagtcgtgaagcga
gaaacatacgaagatattgtaaaacttgatctgccatttaaaacgggtgtaaagcaataa

DBGET integrated database retrieval system