KEGG   Bacillus subtilis subsp. subtilis 168: BSU23390
Entry
BSU23390          CDS       T00010                                 

Symbol
spoVAF
Name
(RefSeq) stage V sporulation protein AF
  KO
K06408  stage V sporulation protein AF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU23390 (spoVAF)
SSDB
Motif
Pfam: GerA
Other DBs
NCBI-GeneID: 938936
NCBI-ProteinID: NP_390220
Pasteur: BG10508
BSORF: BG10508
UniProt: P31845 A0A6M4JKD7
Position
complement(2438372..2439853)
AA seq 493 aa
MPDHKEEKIRVYRNPAKNEEYFKNRVGMGTSYDVGVRKLTILDKEIQLYYLNGLCDTAYI
IHLMRELVAINNRKEDPDELVDIVENRLLNAQVEKVKTLDETTDQVLSGLVAVIVEGAGF
AFIIDVRSYPGRNPEEPDTEKVVRGARDGFVENIVVNTALLRRRIRDERLRVKMTKVGER
SKTDLSICYIEDIADPDLVEIVEKEIASIDVDGLTMADKTVEEFIVNQSYNPFPLVRYTE
RPDVAANHVLEGHVIIIVDTSPSVIITPTTLFHHVQHAEEYRQAPSVGTFLRWVRFFGIL
ASTLFLPIWFLFVLQPDLLPDNMKFIGLNKDTHIPIILQIFLADLGIEFLRMAAIHTPTA
LSTAMGLIAAVLIGQIAIEVGLFSPEVILYVSLAAIGTFTTPSYELSLANKMSRLVLMIL
VALFHIKGLVIGFTVLIIAMASIKSLQTPYLWPLIPFNGKALWQVLVRTAKPGAKVRPSI
VHPKNRLRQPTNS
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgccggaccacaaggaagagaaaattcgggtttatcggaatccagctaaaaatgaagag
tatttcaaaaaccgtgttgggatggggacgagctatgatgtaggtgttcgcaagctcacg
attttagataaagagatccagctttactatctaaatggattatgcgatacagcctatatt
attcatttaatgagagagcttgttgccattaacaatcggaaagaagaccctgatgagctg
gtcgacatcgtcgaaaacaggctgcttaacgcccaggtcgaaaaagtaaaaaccttggat
gaaaccaccgaccaagtgctgtccgggctcgtcgctgtcattgttgaaggtgcaggcttc
gcatttataattgatgtcagaagctatccgggcagaaacccggaagaacctgatacggaa
aaggtggtcaggggagccagagacggatttgttgaaaatatcgtcgtcaatacggccctt
ctcagaaggcggatcagagacgaacgccttcgagtcaagatgactaaagttggtgagcgg
tcaaagacggatttaagcatttgttatatagaagatatagctgatccggatctggttgag
atcgtagaaaaagaaattgcatccattgatgtcgatggattaacaatggcagacaaaact
gtcgaggaattcattgttaatcaaagctataatccttttccgctcgtgcgctatacagaa
agaccggatgtggccgcaaatcatgttctagaaggccatgttatcattatagtggacaca
tcgccgagtgtgatcattaccccgacgactttatttcaccatgtgcagcatgctgaagaa
tataggcaggcgccttcagtcgggacctttttaagatgggtaagatttttcggtattctt
gcttctactttatttcttccgatctggtttctctttgtgcttcagcctgatctgctcccg
gacaacatgaaatttatcggtttaaataaagatacgcatatcccgatcatcctgcagata
tttttagctgacttaggaatcgagtttctcagaatggctgccattcacacaccgacggct
ttatcgacagcaatgggtttaattgccgctgttctgatcgggcagattgcgattgaggtc
ggccttttttctcctgaggtgattctgtacgtctcacttgcggcgattggaacctttacg
acgcctagttatgaattaagcttggcaaacaaaatgagccgtcttgtcctcatgatactc
gttgctttatttcatataaaagggctcgtcatcggatttacagtgctaattattgccatg
gcaagcatcaaatcccttcagacaccgtacttatggccgctgattccctttaacggaaag
gcgctgtggcaggttcttgtccgcacagcgaaacctggcgcaaaagtaagacccagcatc
gttcaccccaaaaatcgcttaaggcagcctaccaattcataa

DBGET integrated database retrieval system