KEGG   Bacillus subtilis subsp. subtilis 168: BSU23401
Entry
BSU23401          CDS       T00010                                 

Symbol
spoVAEA
Name
(RefSeq) stage V sporulation protein AE
  KO
K06407  stage V sporulation protein AE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU23401 (spoVAEA)
SSDB
Motif
Pfam: SpoVAE Peptidase_C13
Other DBs
NCBI-GeneID: 8303022
NCBI-ProteinID: YP_003097758
UniProt: P40870 A0A6M4JM53
Position
complement(2439804..2440415)
AA seq 203 aa
MTTKRKVILVTDGDVYAAKTIEYAASKVGGRCISQSKGNPSTRSGAELVKLIASAPYDPV
FVMFDDSGLQGEGPGEAALTYVATHPSIEVLGVIAVASKTHQAEWTRVDVSIDRNGEITE
YGVDKVGEREFDDHRMSGDTVYCLDKLDLPLIVGIGDIGKMGRKDDISKGSPITMKAVEF
ILERSGYHAGPQGRENSGLSESS
NT seq 612 nt   +upstreamnt  +downstreamnt
atgacgacaaaacgcaaggtcatactggtaacagacggggatgtttatgccgctaaaaca
attgaatacgccgcaagcaaagtgggaggccgatgtatttcacaatcaaaagggaatcct
tccacccgcagcggcgccgagcttgtcaagctgatcgcctcagcaccgtatgatcctgta
tttgtcatgtttgacgactccggccttcaaggagagggcccgggagaagccgctctaacc
tatgtcgcaacccatccgtctattgaagtgctcggtgtgattgcggtcgcgtcaaaaaca
catcaggctgaatggaccagggtcgatgtaagcattgaccgcaatggagaaataactgaa
tacggcgtcgataaagtcggggaaagggaatttgatgaccacagaatgagtggagataca
gtctattgccttgataaacttgatctcccgcttattgtcggtatcggggatatcggcaaa
atgggcagaaaagacgatatctcaaaagggtcgccaatcaccatgaaagcggtcgagttt
attttagaaaggagcgggtatcatgccggaccacaaggaagagaaaattcgggtttatcg
gaatccagctaa

DBGET integrated database retrieval system