KEGG   Bacillus subtilis subsp. subtilis 168: BSU23402
Entry
BSU23402          CDS       T00010                                 

Symbol
spoVAEB
Name
(RefSeq) stage V sporulation protein AEB
  KO
K06407  stage V sporulation protein AE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU23402 (spoVAEB)
SSDB
Motif
Pfam: SpoVAC_SpoVAEB
Other DBs
NCBI-GeneID: 8303020
NCBI-ProteinID: YP_003097759
UniProt: C0H450 A0A6M4JIZ7
Position
complement(2440423..2440773)
AA seq 116 aa
MDYLLAFVCGGAICIVGQLLLDIFKLTPAHVMTSFVVIGAILDGFGIYDKFIEFAGGGAT
VPIVSFGHSLLHGAMHQAHIHGFIGIGMGIFELTSAGISAAILFAFIVAVIFKPKG
NT seq 351 nt   +upstreamnt  +downstreamnt
atggactaccttttggcttttgtctgcggcggggccatctgtatcgtcggccagctgctc
ttggatatttttaaattgacgccagctcatgtcatgacatcatttgttgtaatcggtgca
atattagatggtttcggcatttacgataaatttattgaatttgccggaggaggcgccacc
gttccgatcgtcagcttcggtcacagtcttctgcacggcgccatgcatcaggcgcatata
cacggatttatcggaatcggcatggggatttttgagctgacctcggccggtatctcagcc
gctattcttttcgcctttatcgtagctgttattttcaaaccgaaaggataa

DBGET integrated database retrieval system