KEGG   Bacillus subtilis subsp. subtilis 168: BSU23410
Entry
BSU23410          CDS       T00010                                 

Symbol
spoVAD
Name
(RefSeq) stage V sporulation protein AD
  KO
K06406  stage V sporulation protein AD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU23410 (spoVAD)
SSDB
Motif
Pfam: SpoVAD ACP_syn_III
Other DBs
NCBI-GeneID: 938932
NCBI-ProteinID: NP_390222
Pasteur: BG10895
BSORF: BG10895
UniProt: P40869 A0A6M4JNL7
Structure
Position
complement(2440775..2441791)
AA seq 338 aa
MKLTGKQTWVFEHPIFVNSAGTAAGPKEKDGPLGSLFDKTYDEMHCNQKSWEMAERQLME
DAVNVALQKNNLTKDDIDLLLAGDLLNQNVTANYVARHLKIPFLCMFGACSTSMETVAVA
SALVDGGFAKRALAATSSHNATAERQFRYPTEYGGQKPDTATSTVTGSGAVVISQTPGDI
QITSATVGKVSDLGITDPFDMGSAMAPAAADTIKQHFKDLNRTADDYDLILTGDLSGVGS
PIVKDILKEDGYPVGTKHDDCGLLIYTPDQQVFAGGSGCACSAVVTYSHIFKQLREGKLN
RVFVVATGALLSPTMIQQKETIPTIAHGVVFERAGGAS
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaaattaacaggaaagcaaacctgggtatttgaacatcccatatttgtcaactcagcg
ggaacggcagcaggaccaaaggaaaaagacggaccgcttggctctttatttgataaaacc
tatgacgaaatgcattgtaatcaaaaaagctgggaaatggcggaacggcagctgatggaa
gacgctgttaatgttgcacttcaaaaaaacaatctgacaaaagatgatattgacctattg
ctggcaggcgacttgctgaaccaaaacgtgacggctaactatgtggcaagacacttgaaa
atcccatttctttgtatgtttggcgcctgttcaacatcaatggaaacagtggctgtcgca
tcagccttagttgatggagggtttgccaaaagggcactcgctgccaccagcagtcacaat
gcaactgcggaaagacagtttcgctatccgacagaatacggaggccaaaaaccggacact
gctacctccactgtaaccggaagcggtgcagttgtcatcagtcagacaccgggtgatatc
caaatcacaagtgcgactgtcgggaaggtttctgatttaggaattacagatccttttgat
atgggatcggctatggctccggctgcagctgatacgattaagcagcactttaaagatctc
aaccggacagcggatgactatgatctaatcctgacaggtgacctgtcaggcgtcggttct
ccaatcgtaaaagacattttaaaagaagatggatatccagtcggcacaaagcatgatgat
tgcgggcttctgatttacactccggatcagcaggtctttgccggggggagcggctgtgct
tgttcagcggttgtcacctactctcatatttttaagcagctgagagaaggaaaactaaac
cgtgtatttgtcgtggcgaccggggcgctattaagcccgacgatgatccagcaaaaagaa
accatcccgactatcgcccacggggttgtatttgagcgtgcaggaggtgcatcttaa

DBGET integrated database retrieval system