KEGG   Bacillus subtilis subsp. subtilis 168: BSU23420Help
Entry
BSU23420          CDS       T00010                                 

Gene name
spoVAC
Definition
(RefSeq) stage V sporulation protein AC
  KO
K06405  stage V sporulation protein AC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU23420 (spoVAC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoVAC_SpoVAEB M-factor
Motif
Other DBs
NCBI-GeneID: 938733
NCBI-ProteinID: NP_390223
Pasteur: BG10894
BSORF: BG10894
UniProt: P40868
Position
complement(2441804..2442256)
Genome map
AA seq 150 aa AA seqDB search
MTNIKENYKSKVKTYQPKPPYVWNCVKAFLVGGLICAIGQGLQNFYIHFFDFNEKTAGNP
TAATLILISALLTGFGIYDRIGQFAGAGSAVPVTGFANSMASAALEYKSEGLVLGVATNM
FKLAGNVIVFGVVAAYIVGMIRFAFEKLMS
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacataaaagaaaattacaaatcaaaagtgaaaacatatcagcctaagccgcct
tacgtctggaactgtgtaaaagcctttttagtgggcggactgatttgtgcaatcgggcaa
ggtctgcaaaatttttatatccatttttttgatttcaatgaaaaaactgcggggaatcca
acagctgcaacgctgatattaatttctgccctgcttacagggtttggaatctatgacaga
atcggacaattcgcaggcgcaggttcagccgtacctgtcacgggttttgccaacagtatg
gcaagtgcggctcttgaatataaaagcgaaggattagtgcttggagtagcgacaaatatg
tttaaactggcaggaaatgttattgttttcggagttgtagctgcatacatcgttggaatg
attcggtttgcttttgagaaactgatgtcatag

DBGET integrated database retrieval system