KEGG   Bacillus subtilis subsp. subtilis 168: BSU23440
Entry
BSU23440          CDS       T00010                                 

Gene name
spoVAA
Definition
(RefSeq) stage V sporulation protein AA
  KO
K06403  stage V sporulation protein AA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU23440 (spoVAA)
SSDB
Motif
Pfam: SporV_AA
Other DBs
NCBI-GeneID: 938734
NCBI-ProteinID: NP_390225
Pasteur: BG10892
BSORF: BG10892
UniProt: P40866 A0A6M3ZIP8
Position
complement(2442684..2443304)
AA seq 206 aa
MERRIFIRLRHRVLAHPGDIITVGDAAQIEGQLQLKKKLSAMPLYQVSEKDKNIVILDII
QVLRAIHLQDPTIDVQTVGGAETIVEIQYRKRNLSTVLFIGVWLLLFIGSCLAIMNFHED
VSMRDVHIALYEIITGERNDYPYLLQIPYSIGLGLGMIVFFNHIFKKRLNEEPSPLEVEM
FNYQLDLDQYVAMHENQETIKDLHDR
NT seq 621 nt   +upstreamnt  +downstreamnt
atggaacgacgaatatttatccggcttcgccaccgagtgctggcacatccaggggatatt
attaccgttggagatgccgcgcaaatagaagggcagcttcagctgaaaaagaaactttcg
gctatgccgctttatcaggtgagcgaaaaagataaaaatatcgtaattctggatatcata
caagtcctcagagccattcatttacaagacccgacaattgatgttcaaaccgtaggcgga
gcagaaaccattgttgaaattcagtatcgaaagcgaaatttatcaacggttctatttatc
ggtgtctggctgcttctgtttattggatcgtgtcttgccatcatgaactttcatgaggat
gtaagcatgagagatgttcatatcgcactatatgaaatcataaccggagagaggaatgac
tatccatatttgcttcaaatcccatacagcatcggtttgggactggggatgatcgtgttt
tttaaccacatatttaaaaagcgcctaaatgaagagcccagcccgctggaggttgagatg
tttaactatcagcttgatctcgatcaatatgtggccatgcatgagaatcaagaaaccata
aaggatctgcatgatcgttag

DBGET integrated database retrieval system