KEGG   Bacillus subtilis subsp. subtilis 168: BSU23490Help
Entry
BSU23490          CDS       T00010                                 

Gene name
pupG
Definition
(RefSeq) purine nucleoside phosphorylase 1
  KO
K03783  purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00240  Pyrimidine metabolism
bsu00760  Nicotinate and nicotinamide metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU23490 (pupG)
   00240 Pyrimidine metabolism
    BSU23490 (pupG)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSU23490 (pupG)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     BSU23490 (pupG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-GeneID: 938731
NCBI-ProteinID: NP_390230
Pasteur: BG11330
BSORF: BG11330
UniProt: P46354
Position
complement(2446418..2447233)
Genome map
AA seq 271 aa AA seqDB search
MKDRIERAAAFIKQNLPESPKIGLILGSGLGILADEIENPVKLKYEDIPEFPVSTVEGHA
GQLVLGTLEGVSVIAMQGRFHFYEGYSMEKVTFPVRVMKALGVEALIVTNAAGGVNTEFR
AGDLMIITDHINFMGTNPLIGPNEADFGARFPDMSSAYDKDLSSLAEKIAKDLNIPIQKG
VYTAVTGPSYETPAEVRFLRTMGSDAVGMSTVPEVIVANHAGMRVLGISCISNAAAGILD
QPLSHDEVMEVTEKVKAGFLKLVKAIVAQYE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggacagaattgaacgcgcagccgcttttattaaacaaaacctgccggaatctcca
aagatcggccttattttaggctcaggtcttggcattttggcggacgaaatcgaaaatccg
gtcaagctgaaatatgaagatatacctgaattcccggtatctactgttgaagggcatgcc
ggacagcttgtgcttggcactcttgaaggagtttccgtcattgcaatgcagggccgcttt
catttttatgaaggctactcaatggagaaagtcacattccctgtacgcgtgatgaaagcg
ctcggtgtggaagcgttgatcgtgacaaatgccgcaggcggtgtcaacactgaattccgt
gcgggagatttaatgattattaccgatcatatcaactttatgggaacaaacccgttaatc
gggccaaacgaagcagatttcggcgccagatttccagatatgtcttcagcctatgacaaa
gatctgtccagcctggctgaaaagattgcgaaagaccttaatatcccaattcaaaaaggc
gtgtacactgctgtgacaggaccttcttacgaaacaccggcagaagtccgtttcttaaga
acgatgggctctgatgcagtcggcatgtctactgttccggaagtcattgtagcgaatcat
gcgggaatgcgggttcttggcatttcctgcatctctaacgcggcagccggaattctggat
cagcctttaagtcacgatgaagttatggaagtgaccgaaaaagtaaaagctggattctta
aagcttgttaaagcgatcgtcgctcagtacgaataa

DBGET integrated database retrieval system