KEGG   Bacillus subtilis subsp. subtilis 168: BSU23519
Entry
BSU23519          CDS       T00010                                 

Symbol
yqzK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4227 DUF5683
Other DBs
NCBI-GeneID: 8302907
NCBI-ProteinID: YP_003097760
UniProt: C0H451 A0A6M3ZDG2
Position
complement(2449489..2449716)
AA seq 75 aa
MGRFLKTAVDALKVFILFTGFTALFYYAMIWVNQEYENYHRYDKPEGSAVKVVEMDQDEK
GGWFDRLIFFYQNGE
NT seq 228 nt   +upstreamnt  +downstreamnt
atgggaagattcctgaaaacagctgtcgatgcattgaaagttttcatcctgtttaccggt
tttaccgctttgttctattatgctatgatatgggtgaatcaagagtatgaaaactatcat
cggtatgataaaccggaaggctccgctgtaaaagttgttgaaatggatcaggatgaaaaa
ggcggatggttcgaccggttgatctttttttaccaaaacggggagtag

DBGET integrated database retrieval system