KEGG   Bacillus subtilis subsp. subtilis 168: BSU23520
Entry
BSU23520          CDS       T00010                                 

Symbol
fur
Name
(RefSeq) ferric uptake regulation protein
  KO
K03711  Fur family transcriptional regulator, ferric uptake regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU23520 (fur)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Fur family
    BSU23520 (fur)
SSDB
Motif
Pfam: FUR FlgM
Other DBs
NCBI-GeneID: 938727
NCBI-ProteinID: NP_390233
Pasteur: BG11766
BSORF: BG11766
UniProt: P54574 A0A6M4JIV0
Position
complement(2449841..2450290)
AA seq 149 aa
MENRIDRIKKQLHSSSYKLTPQREATVRVLLENEEDHLSAEDVYLLVKEKSPEIGLATVY
RTLELLTELKVVDKINFGDGVSRYDLRKEGAAHFHHHLVCMECGAVDEIEEDLLEDVEEI
IERDWKFKIKDHRLTFHGICHRCNGKETE
NT seq 450 nt   +upstreamnt  +downstreamnt
atggaaaaccgtattgatcgtattaagaaacaactgcactcatccagctataaacttacg
ccacagcgtgaagcgacagtaagagtgctgcttgaaaacgaagaagaccatttaagcgca
gaagatgtatacctcctcgtaaaagagaaatctcctgagatcggtctcgctacagtatac
cgtacgcttgaattattaactgaattaaaagtcgtagataaaattaactttggagacggt
gtgtcccgttacgaccttcggaaagagggcgcagctcactttcatcaccacttggtgtgc
atggagtgcggagccgttgatgaaattgaagaagatttgcttgaagacgtggaagaaatc
attgaacgtgattggaaatttaagattaaagatcatagattgacgtttcacggcatttgc
caccgctgtaacggaaaagaaactgaatag

DBGET integrated database retrieval system