KEGG   Bacillus subtilis subsp. subtilis 168: BSU23540
Entry
BSU23540          CDS       T00010                                 

Symbol
yqkK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938724
NCBI-ProteinID: NP_390235
Pasteur: BG11765
BSORF: BG11765
UniProt: P54573 A0A6M4JKM9
Structure
Position
complement(2451148..2451363)
AA seq 71 aa
MAKSQAKKKRGHRLRNGGRDVLLSRGSTPSFSTHGRMTKSKKEILNKRKHKNPYDHTAVD
DKDFFVPQKAA
NT seq 216 nt   +upstreamnt  +downstreamnt
atggcaaaaagccaagcgaaaaagaagcgggggcatcgattgagaaacggcggacgtgac
gtcttattatcaagaggcagcacaccatctttcagcacacatggaagaatgacaaaaagc
aaaaaagagattttgaataaacggaagcataagaatccttatgatcatacagcagttgat
gataaggatttttttgtgccccaaaaagccgcctag

DBGET integrated database retrieval system