KEGG   Bacillus subtilis subsp. subtilis 168: BSU23550Help
Entry
BSU23550          CDS       T00010                                 

Gene name
mleA
Definition
(RefSeq) NAD-dependent malic enzyme 1
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00620  Pyruvate metabolism
bsu01200  Carbon metabolism
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU23550 (mleA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU23550 (mleA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     BSU23550 (mleA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M 2-Hacid_dh_C ACT_4 NAD_binding_2 AlaDh_PNT_C IlvN THF_DHG_CYH_C Shikimate_DH F420_oxidored ACT T2SSM_b
Motif
Other DBs
NCBI-GeneID: 938725
NCBI-ProteinID: NP_390236
Pasteur: BG11764
BSORF: BG11764
UniProt: P54572
Position
complement(2451463..2452782)
Genome map
AA seq 439 aa AA seqDB search
MIAKHMIRTLMIETPSVPGNLGRVATAIGLLGGDIGEVETVKVGPNYTMRNITVQVENEE
QLQEVIAAVQALGEGIRLHTVSDEVLSAHEGGKIQMKSKMPIRSLAELGRVYTPGVADVC
RLIEKEPEKASIYTTISNSVAIVTDGTAILGLGNIGSVAGMPVMEGKAALFDQLAGISGI
PILLDTSDPEEIIKTVKHISPGFSGILLEDIGSPHCFEIEDRLKEELNIPVMHDDQHGTA
VVTLAAAISACRSAGVDLKEAKVGQIGLGAAGVAICRMFMAYGVNAVYGTDKSESAMNRL
EQYGGQAVSSIEELMETCDIVIATTGVPGLIKPAFVRSGQVILALSNPKPEIEPEAALQA
GAAYAADGRSVNNVLGFPGIFRGALNAKSTEINHDMLVAAAEAIAACTKQGDVVPQPLDS
KVHHAVAAAVEHAALTAVK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgatagcgaaacacatgattcggacactgatgatcgaaacgccttcggttcccggaaat
cttggaagggtggctacggccatcggccttctgggcggggatattggtgaagtggagacg
gtaaaagtcggacccaattacacaatgcggaatattaccgttcaagtggagaatgaagaa
cagcttcaggaagtgatcgcggctgtacaggccctcggagaagggatcaggcttcacacc
gtatctgatgaagtcctgtccgcacatgaaggcggaaaaatccaaatgaaaagcaaaatg
ccgatccgttcactggcagagctgggacgtgtctacacaccaggtgttgcggacgtgtgc
cgactgatcgaaaaagaacctgaaaaagcttctatttatacaacgatcagcaattctgtt
gcaattgtaacggatggaaccgcaattttaggccttgggaatatcggctctgtggctggc
atgcctgtcatggaaggaaaggctgctttatttgatcagctggcgggtattagcggcatt
ccgatactgcttgatacgagtgatcctgaagaaatcatcaaaacagtaaaacatatttct
ccgggctttagcggcatccttcttgaggatatcggttcgccgcattgttttgaaatcgag
gatcgcctaaaagaggagctgaacatccctgttatgcacgatgaccagcatggtacagct
gtagtgacgctggcagctgccatttcggcatgcaggagtgcgggggttgacctgaaggaa
gcgaaagtggggcaaatcggccttggcgcagcaggcgtggccatctgccggatgttcatg
gcttatggtgtgaatgctgtatacggaacagacaaatcagagtcagcaatgaaccgtctc
gaacaatacggcggacaggcagtttccagtattgaggagcttatggaaacatgtgatatt
gtcattgctacaacgggcgttccgggtttaataaaaccggcatttgtacgttctggtcaa
gtgattctggctttatcgaatccgaagccggaaattgagccggaggccgcactgcaggct
ggcgccgcatatgcagctgacgggcgttctgttaataatgtactcggttttccagggatt
tttagaggagcgcttaacgcaaaaagcacggagattaatcatgatatgcttgtcgcagca
gcagaggccatcgcagcttgcactaaacaaggtgatgttgtccctcagccgcttgattca
aaagtccatcatgcggtagcagcagctgtcgagcatgcagctcttacagcagtgaaataa

DBGET integrated database retrieval system