KEGG   Bacillus subtilis subsp. subtilis 168: BSU23570
Entry
BSU23570          CDS       T00010                                 

Symbol
aspA
Name
(RefSeq) aspartate ammonia-lyase
  KO
K01744  aspartate ammonia-lyase [EC:4.3.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00250  Alanine, aspartate and glutamate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU23570 (aspA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.1  aspartate ammonia-lyase
     BSU23570 (aspA)
SSDB
Motif
Pfam: Lyase_1 FumaraseC_C
Other DBs
NCBI-GeneID: 938721
NCBI-ProteinID: NP_390238
Pasteur: BG10301
BSORF: BG10301
UniProt: P26899 A0A6M3ZGX2
Position
complement(2454347..2455774)
AA seq 475 aa
MLNGQKEYRVEKDFLGEKQIEADVYYGIQTLRASENFPITGYKIHEEMINALAIVKKAAA
LANMDVKRLYEGIGQAIVQAADEILEGKWHDQFIVDPIQGGAGTSMNMNANEVIGNRALE
IMGHKKGDYIHLSPNTHVNMSQSTNDVFPTAIHISTLKLLEKLLKTMEDMHSVFKQKAQE
FDSVIKMGRTHLQDAVPIRLGQEFEAYSRVLERDIKRIKQSRQHLYEVNMGATAVGTGLN
ADPEYIKQVVKHLADISGLPLVGADHLVDATQNTDAYTEVSASLKVCMMNMSKIANDLRL
MASGPRAGLAEISLPARQPGSSIMPGKVNPVMAELINQIAFQVIGNDNTICLASEAGQLE
LNVMEPVLVFNLLQSISIMNNGFRSFTDNCLKGIEANEKRMKQYVEKSAGVITAVNPHLG
YEAAARIAREAIMTGQSVRDLCLQHDVLTEEELDIILNPYEMTKPGIAGKELLEK
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgttaaacggccaaaaagaatatcgcgtggaaaaagacttccttggggaaaaacaaatt
gaagcagatgtttattacggaattcagacgctccgtgcttctgaaaattttccgatcaca
ggatacaaaatccatgaggaaatgattaacgcactggcgattgtgaaaaaagctgcggct
cttgccaacatggacgtgaaacggctgtatgaaggaattggccaagctatcgtacaagcc
gctgacgagattctggaaggcaagtggcacgatcagtttatcgtcgatccgattcagggc
ggtgccggaacttctatgaacatgaacgcgaatgaggttatcggaaaccgggcgcttgaa
atcatgggacataaaaagggagattatatccatttaagtccaaacacacatgtgaacatg
tcacagtctacgaacgatgtgttcccgactgctatccatatttccacattgaagctctta
gaaaaactgctgaaaacaatggaagatatgcatagtgtgtttaagcaaaaagcacaggag
tttgactctgttattaaaatgggccggacacaccttcaagatgcggttccgatccgtctt
ggccaggaattcgaagcttacagccgtgttctcgagcgtgatatcaaacgaatcaagcaa
tcgcgccagcacctgtatgaagtcaacatgggcgcaactgctgttggtacagggctgaac
gctgatcctgaatatatcaaacaggtagtaaagcaccttgctgatattagcgggcttcct
cttgtcggcgctgatcatcttgttgatgcgacacaaaatacagatgcctatacagaggta
tcagcttcattaaaagtctgcatgatgaacatgtcgaagatcgcaaacgacctgcgctta
atggcgtcgggaccgcgcgccggacttgcggaaatttctctgcctgcacgtcagccgggt
tcatctattatgccggggaaagtcaatccggttatggcggagctgatcaaccaaattgcg
ttccaggttatcggaaatgacaatacaatctgccttgcttcagaagccggccagcttgag
ttgaacgtcatggagcccgtgcttgtctttaatttgcttcaatccatcagcatcatgaac
aacggcttccgttcgttcactgacaactgcttaaaaggcattgaagccaacgaaaagcgt
atgaagcaatacgtagaaaaaagcgcaggcgtgatcacagctgtcaatccgcatcttggg
tatgaagcggcagctagaattgccagggaagcaattatgacagggcaatctgtccgggat
ctttgtctgcagcatgatgtgctgactgaagaagaattggatattattttaaacccatat
gagatgaccaaaccaggtatcgcagggaaagaactattagaaaaataa

DBGET integrated database retrieval system