KEGG   Bacillus subtilis subsp. subtilis 168: BSU23650Help
Entry
BSU23650          CDS       T00010                                 

Gene name
yqkC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2552
Motif
Other DBs
NCBI-GeneID: 938711
NCBI-ProteinID: NP_390246
Pasteur: BG11758
BSORF: BG11758
UniProt: P54566
Position
complement(2461621..2461860)
Genome map
AA seq 79 aa AA seqDB search
MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTT
IDLAIEWIRENMDGITDVL
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
gtggaacaaaagctgaaggcaatgaagaacacagcacaaaataaaacgtgggtatccttc
ctgaatcaaaaccatccttataccttgcttcactggtcaatcggaggagcagagtccatc
aagaaagatgtctggctattgcaggatgaaatgaccttcgagacgcaggagtttacaacg
atagatcttgcgattgaatggatcagagaaaatatggatggcattaccgacgttctgtaa

DBGET integrated database retrieval system