KEGG   Bacillus subtilis subsp. subtilis 168: BSU23660
Entry
BSU23660          CDS       T00010                                 

Symbol
yqkB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Fe-S_biosyn
Other DBs
NCBI-GeneID: 938713
NCBI-ProteinID: NP_390247
Pasteur: BG11757
BSORF: BG11757
UniProt: P54565 A0A6M4JKG3
Position
complement(2461873..2462196)
AA seq 107 aa
MNIHVTDAAKQALQQAFDANPGKKAQLRYDAEGCGCAVSGVPTIWLAEELTGQCEQLETN
GIPLYIQSSQKVFFDDQMTIDYNEKAKTLALKSPAEMLSPRMSILVK
NT seq 324 nt   +upstreamnt  +downstreamnt
atgaacatacatgtgacagatgcagcaaaacaggcactgcagcaggcgtttgacgccaac
ccgggaaaaaaagcccagcttcgttacgatgcagaaggatgcggctgcgcggtaagcggt
gtcccgacaatctggctggcagaagaattaacgggacagtgcgagcagctggaaacgaac
ggcattccgctgtatatccaatcgtcgcaaaaagtgttttttgacgatcaaatgacgatc
gattacaatgaaaaagccaaaacattggcgctgaaaagcccggctgaaatgctcagcccc
agaatgagcatattagtaaagtag

DBGET integrated database retrieval system