KEGG   Bacillus subtilis subsp. subtilis 168: BSU23670
Entry
BSU23670          CDS       T00010                                 

Symbol
yqkA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GrpB Acetyltransf_10 Acetyltransf_1 Acetyltransf_7 Acetyltransf_4 FR47 Acetyltransf_CG Acetyltransf_3 MHB Acetyltransf_8
Other DBs
NCBI-GeneID: 938712
NCBI-ProteinID: NP_390248
Pasteur: BG11756
BSORF: BG11756
UniProt: P54564 A0A6M4JM70
Position
complement(2462193..2463224)
AA seq 343 aa
MIEFLQHKEATIAREILAVQIPAYIKETEIIGFDGIPALQEKVKDIQASHERFAGYRKNG
KLIGVISYEKNMHYLTICRLVVHPDGFRKGIGRALLQFVIDHNEDAEKIEVVTAENNTPA
VSLYTQAGFQKAETVKAAQGLLLSVFHLYPKRKVEIILYNEKWAECFDEEKERLKLVFGP
EIIAIHHIGSTSIPNMAAKPIIDMLIEVRSIEAVSQFDEQMKANGYTPKGENGIAGRRYF
QKGGNKRTHHVHMYEQGNPAIERHLLFRDYLRAHPNIAKEYAVLKKQLAAQHPDSINQYI
QGKDEWIKTAEENAKRWKKGRNNANGSIVCYNSENDENGGFTL
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgattgaatttctccagcataaggaagccactatagcgcgtgagattttagccgtacag
atccccgcctacataaaggaaacagagattatcggttttgacggtattcccgctttacaa
gagaaggtaaaggatattcaagcatcccatgaacggtttgcgggatatcggaaaaacggc
aagctgatcggtgtcatttcatatgagaaaaacatgcattatctcaccatttgcaggctt
gttgtgcatcctgacggtttcagaaaaggaattggacgagcgcttctgcaatttgtcatt
gatcataatgaagacgctgagaaaatcgaagtagtcacagccgagaacaataccccggct
gtgtcactctatacacaggccggattccaaaaggcagaaaccgtcaaagcagcgcagggt
ctattgctgtcggtctttcatttgtatccgaaaagaaaagttgagatcattctctacaac
gaaaaatgggcagaatgtttcgatgaagaaaaagaacggctgaaacttgtgttcgggccg
gagattatcgctattcatcacatcggaagcacatcaatacctaacatggcagcgaagcca
atcattgatatgttaattgaagtcagaagcattgaagccgtgagccaatttgatgaacaa
atgaaggccaacggctatacaccaaaaggtgagaacggtatagcgggcaggcgttatttc
caaaagggcggaaataaacgcactcatcatgtccatatgtacgaacagggaaaccctgct
attgaaaggcatctgttattcagagattatctcagagctcatccaaacatagcgaaagaa
tacgccgttctcaaaaaacagctggcggcccagcaccctgacagcatcaatcagtatata
caagggaaagatgagtggatcaagactgcagaagaaaatgcgaagcggtggaaaaaaggc
agaaacaatgcgaatggcagtattgtatgctacaatagcgaaaatgatgaaaacgggggt
ttcaccttatga

DBGET integrated database retrieval system