KEGG   Bacillus subtilis subsp. subtilis 168: BSU23680
Entry
BSU23680          CDS       T00010                                 

Symbol
yqjZ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ABM DUF4188 DUF3291 Dabb
Other DBs
NCBI-GeneID: 938708
NCBI-ProteinID: NP_390249
Pasteur: BG11755
BSORF: BG11755
UniProt: P54563 A0A6M4JJ20
Structure
PDB: 
2GO8

Position
complement(2463217..2463561)
AA seq 114 aa
MMDFLSKTPEPPYYAVIFSSVKSENDTGYGETAERMVSLAADQPGFLGVESVREADGRGI
TVSYWDSMDAINHWRHHTEHQAAKEKGRSVWYESYAVRVAKVDRQRLFQENTND
NT seq 345 nt   +upstreamnt  +downstreamnt
atgatggattttttatcaaaaacacctgagcctccttactatgcagtcattttttcttct
gtcaaaagcgaaaatgacacaggatatggagaaacagcggagcggatggtatcacttgcg
gcggatcagcctggatttttaggcgtggaaagcgtacgtgaagcggatggaaggggcatc
acagtttcctattgggacagtatggacgcaattaaccattggaggcatcacactgaacat
caagcagcaaaagaaaaaggaagaagcgtttggtacgagtcgtatgcagtccgcgtcgca
aaagtcgacagacagcggctgtttcaggagaacacgaatgattga

DBGET integrated database retrieval system