KEGG   Bacillus subtilis subsp. subtilis 168: BSU23690Help
Entry
BSU23690          CDS       T00010                                 

Gene name
yqjY
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_6 FR47 Acetyltransf_3 Acetyltransf_4
Motif
Other DBs
NCBI-GeneID: 938709
NCBI-ProteinID: NP_390250
Pasteur: BG11754
BSORF: BG11754
UniProt: P54562
Structure
PDB: 

Position
complement(2463571..2464041)
Genome map
AA seq 156 aa AA seqDB search
MDIRTITSSDYEMVTSVLNEWWGGRQLKEKLPRLFFEHFQDTSFITSEHNSMTGFLIGFQ
SQSDPETAYIHFSGVHPDFRKMQIGKQLYDVFIETVKQRGCTRVKCVTSPVNKVSIAYHT
KLGFDIEKGTKTVNGISVFANYDGPGQDRVLFVKNI
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggatattcgaacaatcacgtcttcagattatgaaatggtaacgtctgtactgaatgaa
tggtggggcggcagacagctgaaagaaaaattgccgagactattttttgagcattttcag
gacacaagctttattacatccgaacataacagcatgacgggatttttaatcggatttcaa
tcgcaatccgatcctgaaacggcgtacattcatttttccggtgtgcatccggatttcaga
aaaatgcaaattgggaaacaattgtatgatgtatttatcgaaacagtaaaacaaaggggc
tgcacccgggtgaagtgtgtcacttcacctgtgaataaggtatcaatcgcatatcacaca
aaattggggtttgatattgaaaagggcaccaaaacggtaaatggcatctcagtgtttgca
aactatgatggcccgggccaagacagggtactatttgtcaaaaacatatga

DBGET integrated database retrieval system