KEGG   Bacillus subtilis subsp. subtilis 168: BSU23700
Entry
BSU23700          CDS       T00010                                 

Symbol
yqjX
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YolD
Other DBs
NCBI-GeneID: 938710
NCBI-ProteinID: NP_390251
Pasteur: BG11753
BSORF: BG11753
UniProt: P54561 A0A6M4JND8
Position
complement(2464227..2464565)
AA seq 112 aa
MNDHLKRGNLLWEGSRMFLPEHKQSLLERKRLKQKLQKPILDPDKLEEMNQTLCAAMEFA
QDITVSCFQDGEIVCCTGKICRYEEFEKAVWIKGDEDQLYKLKLDQVLDIVL
NT seq 339 nt   +upstreamnt  +downstreamnt
atgaacgaccatttaaaaaggggcaacctgctgtgggaagggagcaggatgtttctgccg
gaacataagcaaagcctgctggagagaaagcgacttaaacagaagctgcaaaagccgatc
cttgaccccgataagctggaagagatgaatcaaacgctttgcgccgcgatggagtttgct
caggatatcactgtcagctgctttcaggacggtgagattgtctgctgcaccgggaaaatc
tgccggtatgaagagtttgaaaaagcagtatggataaaaggagacgaggatcagctttat
aagctgaaacttgatcaagtgcttgatattgtgctgtaa

DBGET integrated database retrieval system