KEGG   Bacillus subtilis subsp. subtilis 168: BSU23710
Entry
BSU23710          CDS       T00010                                 

Gene name
yqjW
Definition
(RefSeq) DNA polymerase IV 2
  KO
K02346  DNA polymerase IV [EC:2.7.7.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU23710 (yqjW)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BSU23710 (yqjW)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    BSU23710 (yqjW)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH
Other DBs
NCBI-GeneID: 938705
NCBI-ProteinID: NP_390252
Pasteur: BG11752
BSORF: BG11752
UniProt: P54560 A0A6M3ZDS1
Position
complement(2464562..2465800)
AA seq 412 aa
MMKEKVIFLVDMQSFYASVEKAENPHLKNRPVIVSGDPEKRGGVVLAACPLAKQKGVVNA
SRLWEAQEKCPEAVVLRPRMQRYIDVSLQITAILEEYTDLVEPYSIDEQFMDITGSQKLF
GTPMEIAKSIQGRIMREIGVYARVGIGPNKALAKIACDNFAKKNKNGIFTLTKENMKTEM
WPLPVGSMFGVGSRMKHHLNRMGISTIGGLAAFPLDLLKKKWGINGHVLWMTANGIDYSP
VSTSSLDGQKAIGHGMTLPRDYEHFDKEIKVVLLELSEEVCRRSRNAGVMGQTVSVSCRG
ADFDWPTGFNRQVKLAEPTNSTQDVYEAVRRLFLTFWDGKPVRRLGVNLSQLSSDDIWQL
NLFQDYAKKMSLGYVMDGIKNRFGDTAIIRAASLTAAGQAFERAAKIGGHYK
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgatgaaagaaaaagtgatttttctcgttgacatgcaatcgttttatgcatctgtagag
aaagcggaaaatccacatttgaaaaataggcccgtcattgtttcgggtgaccctgaaaaa
aggggcggagtcgtattggctgcctgcccgctggcgaaacaaaagggtgtggtgaatgct
tcacggctgtgggaggcgcaggaaaagtgtcctgaggctgttgtgctccggccgcgtatg
cagcggtatattgatgtatcactgcaaattacggccattctcgaggagtatacagacctt
gtggagccgtattccatcgatgaacagttcatggacattacaggcagccagaagctgttt
gggacgccgatggagatcgcgaaaagcattcagggcagaatcatgcgggagatcggcgtt
tatgcacgggtcggaatcggccctaacaaagcgctggccaaaattgcgtgtgacaatttt
gccaaaaagaataagaacggtatttttaccttaacgaaagaaaatatgaaaaccgaaatg
tggccgctcccggtgggcagcatgtttggcgtcgggagccgcatgaagcatcatttaaat
cgaatgggcatcagcacgatcggcgggctcgcggcttttccgctcgatcttttaaaaaag
aaatggggcattaacggccacgtgctgtggatgacggcaaacggaatcgactattcccct
gtgtcaacttcgtctctggacgggcaaaaggcgataggtcatggaatgactctcccgaga
gactacgaacactttgacaaagaaatcaaggtcgtattgcttgagctgagtgaagaggtg
tgcaggcgaagccgaaacgccggggtcatggggcagacagtgtcagtgagctgccggggt
gctgattttgattggccgacgggcttcaaccggcaagtgaagctggcagagccgactaat
tctacgcaggatgtatatgaggctgtacgacggctgtttcttacattttgggacgggaaa
cccgtccgccgcctcggtgtcaatctgtctcagctctcatctgatgacatatggcagctc
aatttatttcaggattatgcaaagaaaatgagcctaggctatgtgatggatggcattaaa
aatcgattcggcgatacagcaatcatcagggcggcgtcactgacagcggcaggccaggca
tttgaacgtgcggctaaaataggggggcattataaatga

DBGET integrated database retrieval system