KEGG   Bacillus subtilis subsp. subtilis 168: BSU23720
Entry
BSU23720          CDS       T00010                                 

Symbol
yqzH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YqzH HI0933_like
Other DBs
NCBI-GeneID: 938707
NCBI-ProteinID: NP_390253
Pasteur: BG13774
BSORF: BG13774
UniProt: O32014 A0A6M3ZIP1
Position
2465966..2466172
AA seq 68 aa
MEKFVEKMLGQALRQYGRNVAIDPLSPYEKQSLKAALQERRNEEPDEDLHAHIEDIIYDY
VTNQGLFS
NT seq 207 nt   +upstreamnt  +downstreamnt
atggagaaatttgtcgaaaaaatgctgggacaggcattgcggcaatacggcagaaacgtt
gctatagatccgttaagcccgtatgaaaaacaaagcctgaaagcggctctacaagagaga
cggaatgaagaaccagatgaggatttgcatgcgcatatagaagatatcatttatgactat
gtcacaaaccaaggcctgttctcttaa

DBGET integrated database retrieval system