KEGG   Bacillus subtilis subsp. subtilis 168: BSU23730
Entry
BSU23730          CDS       T00010                                 

Symbol
yqjV
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like MFS_2 LacY_symp Nuc_H_symport MFS_3
Other DBs
NCBI-GeneID: 938706
NCBI-ProteinID: NP_390254
Pasteur: BG11751
BSORF: BG11751
UniProt: P54559 A0A6M3ZDX8
Position
2466721..2467953
AA seq 410 aa
MKKWKDIHPISWTIIIGTIFGRMATSMSIPFLAIYLTAVQGASASYAGLVIAASSSVGIL
ASFYGGYISDKFGRKNMMLVSIFGWMLVFAGFAAASNLWVFFVVNALNGLCKSLFEPASK
ALLSDMTEEKTRLLVFNLRYAAINIGVVFGPVLGLYFGSSQSTTPFLVPAVIYGLYGIVL
ALQFKKHPSLSAPAQSRNMSVREAFMVTQKDYLFTIALVGITLCTFGYSQFSSTFPQYMA
QNPLIGNGTKLYGLMLTLNAIVVLATQFPIVHFAKRFSPLCSLMLGNVMVSISMAIFTVS
HGVPSIVMIVITFTIGEVLLFSMMDLYVDQIAKPGLKGTYFGAIGFSQLGNVIGPWVGGI
CIDLFGAGRPIYIFSVLSGITLLGLPFLAFAYRQMKMETTKHRSRLEKPL
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgaagaaatggaaagatatccacccgatcagctggacaattataatcggaaccattttc
ggcagaatggcaacatcgatgagcattccttttttagcgatttatttgacagccgtccaa
ggcgcatcagcttcctatgcagggctggtcatcgccgcgagctcatcagtcggcatcctc
gcaagcttttacggcggatatatctcagataaattcggcagaaaaaacatgatgcttgta
tcgattttcggatggatgctggtatttgcaggctttgcggcagcatctaatctctgggtg
ttttttgtagtaaacgcattaaacggtctttgcaaatcactgtttgagcccgcttcaaag
gccttgttgtctgatatgacagaagaaaaaacgagactgctagtttttaatttacgctat
gcggctattaatatcggcgttgtcttcggacctgtgcttggcctatatttcggctcatcg
caatcgactacgccctttttggtgcctgcagtcatttacggactatacggaattgtgctt
gccctccaatttaaaaaacatccatccttatcagcaccagcccagtcccgaaatatgagc
gtgcgggaagcgtttatggtcacgcaaaaggattatctttttaccattgctttggtcggc
attacgctatgcaccttcggctactcacaattcagttccacattccctcagtatatggcg
cagaaccccttgatcggcaatggaacgaagctgtatgggctgatgctgacattaaacgca
atcgttgtgttggcgacgcaatttcccattgtccattttgcaaaacggttttcgccgctt
tgttctctgatgctcggtaatgtgatggttagcatcagcatggccattttcaccgtatca
cacggtgttccatcaattgtgatgattgtcatcacatttacaatcggcgaagtgctttta
ttctctatgatggatttgtatgtagaccagattgcaaaaccaggattaaaaggcacttat
ttcggggcaatcggtttttcacagctcggaaacgtcatcggcccttgggtcggggggata
tgtatagacctgtttggcgctggccggccgatttatattttttctgtcctgagcggcatt
accctgctcggcctgccatttttagcgttcgcctatcggcaaatgaaaatggagaccaca
aaacaccgttcccgtctggaaaagccgctttaa

DBGET integrated database retrieval system