KEGG   Bacillus subtilis subsp. subtilis 168: BSU23740
Entry
BSU23740          CDS       T00010                                 

Gene name
yqjU
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MscL DUF4083 Pilin_N RAMP4 Tetraspanin SieB DUF2615
Other DBs
NCBI-GeneID: 938702
NCBI-ProteinID: NP_390255
Pasteur: BG11750
BSORF: BG11750
UniProt: P54558
Position
2467971..2468162
AA seq 63 aa
MNLSRKHEVKNMNIGDVMFQLFVFIIFAAVVFAAVTGFKYAKNRKAQLDRIEKKLNSLSE
DHD
NT seq 192 nt   +upstreamnt  +downstreamnt
atgaatctctcccgcaaacatgaggtgaagaacatgaatataggtgatgtgatgtttcag
ctgtttgtatttattatatttgccgctgtcgtctttgcggctgttacaggcttcaagtat
gcgaaaaaccgaaaagcgcagctggatcgcattgagaaaaagctgaacagcctgtccgaa
gatcacgattaa

DBGET integrated database retrieval system