KEGG   Bacillus subtilis subsp. subtilis 168: BSU23750
Entry
BSU23750          CDS       T00010                                 

Gene name
yqjT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4
Other DBs
NCBI-GeneID: 938703
NCBI-ProteinID: NP_390256
Pasteur: BG11749
BSORF: BG11749
UniProt: P54557 A0A6M3ZDE3
Position
complement(2468159..2468545)
AA seq 128 aa
MHHIELYVSDLEASRRFWGWFLKELGYKEYQKWSSGISWKKDRFYLVIVQAKEPFLEPEY
HRCRVGLNHLAFHAESKLQVDQMTEKLTAKGYRVLYRDRHPFAGGDGHYAVFCEDPDRIK
VELVAPSC
NT seq 387 nt   +upstreamnt  +downstreamnt
gtgcatcatattgaactgtatgtctctgatttggaggcgtctaggcggttttggggctgg
ttcttaaaagaacttggttataaagagtatcaaaaatggagctcaggcatcagctggaag
aaagatcgtttttacctagtgattgtgcaggcgaaagagccatttctagagccggaatac
catagatgccgagtcggtctgaaccatctcgcatttcatgctgaatccaagcttcaagtc
gatcagatgactgaaaaattgacggcaaaaggctatcgtgtgttgtaccgagacaggcat
ccttttgccggaggagacgggcattatgcagtcttttgtgaggatccagaccggattaag
gtagagctcgttgccccaagctgttaa

DBGET integrated database retrieval system