KEGG   Bacillus subtilis subsp. subtilis 168: BSU23780
Entry
BSU23780          CDS       T00010                                 

Gene name
yqjQ
Definition
(RefSeq) oxidoreductase
  KO
K07124  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU23780 (yqjQ)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Polysacc_synt_2 3HCDH_N Sacchrp_dh_NADP Epimerase
Other DBs
NCBI-GeneID: 938699
NCBI-ProteinID: NP_390259
Pasteur: BG11746
BSORF: BG11746
UniProt: P54554 A0A6M3ZDR3
Position
complement(2471002..2471781)
AA seq 259 aa
MKHIAGKRIWITGASGGLGERIAYLCAAEGAHVLLSARREDRLIEIKRKITEEWSGQCEI
FPLDVGRLEDIARVRDQIGSIDVLINNAGFGIFETVLDSTLDDMKAMFDVNVFGLIACTK
AVLPQMLEQKKGHIINIASQAGKIATPKSSLYSATKHAVLGYSNALRMELSGTGIYVTTV
NPGPIQTDFFSIADKGGDYAKNVGRWMLDPDDVAAQITAAIFTKKREINLPRLMNAGTKL
YQLFPALVEKLAGRALMKK
NT seq 780 nt   +upstreamnt  +downstreamnt
gtgaaacatatagcgggaaaaaggatttggataaccggcgcttcaggagggcttggagaa
agaatcgcatacttatgcgcggctgaaggagcccatgtcctgctgtcggctagacgcgag
gatcgtttgatagaaatcaaaaggaaaataaccgaggaatggagcggacagtgtgagatt
tttcctctggatgtcggccgcctagaggatatcgcccgggtccgcgatcagatcggctcg
attgatgtactgattaacaatgcaggcttcggtatatttgaaacggttttagactctaca
ttggatgacatgaaagcgatgtttgatgtgaatgtcttcggcctgatcgcctgtacaaaa
gcggtgcttccgcaaatgcttgagcaaaaaaagggacatatcatcaatatcgcctctcaa
gcggggaaaatcgccacaccgaagtctagcctgtattccgcgaccaaacatgccgtgtta
ggttactcaaacgctttgcggatggagctttcgggaaccggcatttatgtgacaacagtc
aacccgggcccgattcagacggactttttttccattgctgataaaggcggggactacgcc
aaaaatgtcggccgctggatgcttgatcctgatgacgtggcagctcaaattacagctgca
atttttacgaaaaagcgggagatcaatcttccgcgtttaatgaatgccggcactaagctg
tatcagctgtttccagctcttgtagaaaagctggcaggacgcgcgctcatgaaaaaataa

DBGET integrated database retrieval system