KEGG   Bacillus subtilis subsp. subtilis 168: BSU23790
Entry
BSU23790          CDS       T00010                                 

Symbol
yqjP
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2 HTH_20
Other DBs
NCBI-GeneID: 938701
NCBI-ProteinID: NP_390260
Pasteur: BG11745
BSORF: BG11745
UniProt: P54553 A0A6M4JNM4
Position
complement(2471787..2472746)
AA seq 319 aa
MTTEDVIAIRVPTPFAVGDVIVYLVKGDALTLIDAGPNTKEAARALQEQLAAVNVKLSDI
EQVVLTHHHADHAGLLDVFSDEIEVIGHTFNEPYISQNQAFMDWQKRFFQKLLPELGVPF
DTGKAEKLIRSAYAFSCTRSLTKSIREGMGIDGLEGWSVLEMPGHAESHIVLFHEKSGRM
LGGDLLLANSSSNPILEAPKAGDVRSKPLVDYQRSLRRLSQLDPTIVFPGHGEPITSVQA
LIEKRFDKQRNRTEDVRRMLDEKPMTAFQVCQQLFPAVYEKELFLTMSETAGHLDVLEAE
EAITSYWEGNTVYFKTMKR
NT seq 960 nt   +upstreamnt  +downstreamnt
atgacaactgaagatgtaattgcgatccgcgtcccgacaccgtttgctgtcggcgatgtt
atcgtttacctcgtaaaaggtgatgcgctgacacttatcgatgccgggccgaatacaaaa
gaggctgccagagccttacaagagcagcttgccgctgtaaatgtgaaattgtcagatatc
gagcaggttgtactgactcaccatcatgctgatcatgcaggcttgcttgatgtcttttca
gatgaaatcgaagtgattgggcatacattcaacgaaccttatatcagccaaaatcaagcc
tttatggattggcaaaaacgtttttttcaaaagctgctgcctgaattaggcgttccattt
gatacggggaaggcggaaaagctgattcgatcagcgtacgcattttcctgtacgagatct
ctgacaaaatcaatcagagaaggtatgggcatagatgggcttgagggctggtctgtgttg
gagatgcctggacatgctgaatcgcatattgttctgttccatgaaaaaagcggaaggatg
cttggcggcgatctactgctggcaaacagctcgtctaatccgattttggaagcgccgaaa
gcgggagacgtcaggtcaaagcctttagtggattatcagcggtcattgcgaaggctgtct
caacttgatccaacaatcgtatttcctggtcacggcgagcctatcaccagtgtacaagcg
ctgattgagaagcgttttgacaagcagaggaacaggacggaggatgtgcgtcgcatgctg
gatgaaaagccgatgaccgcttttcaggtctgtcagcagctttttcctgctgtatatgaa
aaggaattgtttttaacgatgtcagaaacggcaggtcaccttgatgtgttggaggctgaa
gaagccatcacgtcatattgggaaggaaataccgtatactttaaaacaatgaagaggtga

DBGET integrated database retrieval system