KEGG   Bacillus subtilis subsp. subtilis 168: BSU23800
Entry
BSU23800          CDS       T00010                                 

Symbol
proI
Name
(RefSeq) pyrroline-5-carboxylate reductase 2
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00330  Arginine and proline metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BSU23800 (proI)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     BSU23800 (proI)
SSDB
Motif
Pfam: P5CR_dimer F420_oxidored Shikimate_DH ApbA NAD_binding_2 Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 938697
NCBI-ProteinID: NP_390261
Pasteur: BG11744
BSORF: BG11744
UniProt: P54552 A0A6M4JNE1
Position
2473151..2473987
AA seq 278 aa
MKKIGFVGAGSMAEAMINGILQSGITKPEHIYITNRSNDERLIELKETYSVRPCRDKNEF
FTHTDIIILAFKPKDAAESIDSIRPYIKDQLVISVLAGLTIETIQHYFGRKLAVIRVMPN
TSAAIRKSATGFSVSTEASKNDIIAAKALLETIGDATLVEERHLDAVTAIAGSGPAYVYR
YIEAMEKAAQKVGLDKETAKALILQTMAGATDMLLQSGKQPEKLRKEITSPGGTTEAGLR
ALQDSRFEEAIIHCIEETAKRSAEIKEQFAGAALERHS
NT seq 837 nt   +upstreamnt  +downstreamnt
atgaaaaagataggatttgtcggcgccgggtcaatggcagaagcaatgatcaacggcatt
ttgcaaagcggcatcacaaaaccagaacatatctatattacaaatcgctcaaatgacgag
cgtctgattgaattaaaggaaacgtacagcgtgcgtccatgcagagataaaaatgagttt
ttcactcacaccgatatcattatcctcgctttcaaaccgaaagacgcggcggaaagcatc
gacagcatccggccgtatatcaaggaccagcttgtcatttcagtacttgcaggccttacc
atcgaaaccattcagcattattttggcagaaagctcgcggtcattcgcgtcatgcctaat
acatcagcggcaatcagaaaatcagcaaccggattttccgtaagcacggaagcaagcaag
aatgatattattgccgcaaaagctctattggaaacaatcggtgatgcaacactggttgag
gagcggcatcttgacgctgtcactgcaatcgcaggcagcggcccggcctatgtgtatcgt
tatattgaggcgatggaaaaagcagcacaaaaagtaggattagataaagaaacggcaaaa
gcactcattttgcagacaatggcaggggcaacagatatgctcctccaaagcggcaaacag
ccggaaaagctgcgtaaagaaatcaccagtcctgggggcactacagaggcaggtcttcgc
gctttacaggactcccgctttgaagaagcaattattcactgtattgaagaaacagctaaa
cggagcgcagaaatcaaagaacagtttgccggtgccgccttagagagacattcttag

DBGET integrated database retrieval system