KEGG   Bacillus subtilis subsp. subtilis 168: BSU23810
Entry
BSU23810          CDS       T00010                                 

Symbol
yqjN
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_M20
Other DBs
NCBI-GeneID: 938696
NCBI-ProteinID: NP_390262
Pasteur: BG11743
BSORF: BG11743
UniProt: P54551 A0A6M4JIX2
Position
complement(2474028..2475671)
AA seq 547 aa
MNWQTKDELLALLTSLVQYESITGSKGEVALAEYLYFILKDKPYFQKHPDDVTLHPMDDG
RSFLTALVKKKNVKKTVLLLSHFDVVDIEDYGEFKHMACKPAELLSSFLEKKELLPERVR
RDAESGDWLFGRGTMDMKAGLCIQLSMLERAMNGHFEGNLLLITVPDEEVNSRGMIEAVP
ALKEMEKKHDITLTACLNAEPMFEKFPGDQQQYFYTGSIGKVLAGFFCKGIETHVGEPFS
GLNANLMVSEINRLLELNADYCEKVDGEVTPPPVNLMQKDLKEAYSVQTPHTAVTLFNVL
SMKRSASELHQMLLKTAEQAAEEIMSNVRKKTQDFQQFEPFQPIERDVTVLTFDELVSRA
KKRAGISETERALNYAFANRGELGDRDFSTKIVSELASLCKEDAPLIVLFYSPPLYPAVS
SKDDQLIRNTADQIKHYAAERYGIALREVQYFPGLSDLSYLQLEKQEVDAYTSNMPLFNR
GYSLPSGKNQALYVPVLNVGPAGKDPHKWTERLYMPYSFEVLPDLLSFTISALLKQSESA
GQLLREK
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgaattggcagacgaaggacgaattgctggcacttttaacttctcttgtgcaatacgaa
agcatcaccggttcaaagggcgaggtagcgcttgcagagtatctttattttattttgaag
gacaagccctattttcaaaagcaccctgatgatgtaacacttcatccgatggacgatggc
agatcttttcttacggctctagtcaaaaagaagaatgtcaaaaagacagtgcttctgctg
agtcattttgatgtcgttgacatagaagattacggcgaatttaaacatatggcttgcaag
cctgctgagcttttgagctcctttttagagaaaaaagagctgctcccggaacgtgtgaga
agagatgccgaaagcggagactggctgttcggaagagggacgatggatatgaaagcgggg
ctttgtattcaactgtcgatgctggagagggcaatgaacgggcattttgagggcaatctg
ctgttgataacggttccggacgaggaagtgaattcaagaggcatgattgaagcggttcct
gcattgaaggagatggagaaaaagcatgatatcacattaaccgcttgcctgaatgccgaa
ccgatgtttgaaaaatttcccggcgatcagcagcaatatttttatacaggaagcattggc
aaggtgcttgcgggttttttctgcaaggggattgagacacatgttggagagccgttttca
ggtctaaacgcaaatttaatggtatctgagattaaccgtttgcttgaactgaatgctgat
tattgcgaaaaggttgatggcgaggtcactccgccgccggtaaacttaatgcaaaaggac
ttgaaagaggcatattcagtccagacaccgcatacagccgtcacattatttaatgtgctg
tcaatgaaacgctcagctagtgagctgcatcagatgctgcttaaaacagcagaacaggcg
gcggaggaaatcatgtcgaacgttcggaagaaaacacaggattttcaacaatttgagcca
tttcagccgattgagcgggacgtcactgttttgacatttgatgagctggtctcgcgtgca
aaaaagcgtgcggggatctcggaaacagagcgggctctaaattatgcctttgctaacagg
ggggagcttggagacagggatttttcgacgaaaattgtttctgagcttgcttcgctttgt
aaggaggatgcgccgctcatcgttctgttttatagtccgccgctttatccagctgtttct
tcaaaggatgatcaattgatcagaaatacagcagatcagataaagcattatgcggctgag
cgatacggcattgcattacgggaggttcagtacttccccggactttcggacttgagttat
cttcagctggaaaaacaggaggttgatgcatacacaagcaatatgccgctctttaacaga
gggtattcattgccaagcggtaaaaatcaggctttatatgtcccagttttaaatgtcggt
ccggctggtaaagacccgcataaatggacggaaagattgtatatgccttattcctttgaa
gtgcttcccgatttgctttcatttacgatctccgcgctattaaagcaatcagaatctgcc
ggccagctgctgcgggaaaaataa

DBGET integrated database retrieval system