KEGG   Bacillus subtilis subsp. subtilis 168: BSU23830
Entry
BSU23830          CDS       T00010                                 

Symbol
yqjL
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Thioredoxin SIS
Other DBs
NCBI-GeneID: 938693
NCBI-ProteinID: NP_390264
Pasteur: BG11741
BSORF: BG11741
UniProt: P54549 A0A6M3ZDY7
Position
2476969..2477730
AA seq 253 aa
MKSAWMEKTYTIDGCAFHTQHRKGSSGVTIVFEAGYGTSSETWKPLMADIDDEFGIFTYD
RAGIGKSGQSRAKRTADQQVKELESLLKAADVKPPYLAVSHSYGAVITGLWACKNKHDII
GMVLLDPALGDCASFTFIPEEMHKSHTRKMMLEGTHAEFSKSLQELKKRQVHLGNMPLLV
LSSGERTEKFAAEQEWQNLHSSILSLSNQSGWIQAKNSSHNIHHDEPHIVHLAIYDVWCA
ACQQAAPLYQAVN
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaaatcagcttggatggaaaagacatatacaattgacggatgtgcgtttcatacacag
caccggaaaggatcaagcggtgtaacgattgtctttgaggccggctatggtacttcttct
gagacgtggaaaccattaatggcggacattgatgatgaatttggcattttcacatatgat
cgggcaggcataggaaaaagcgggcaaagcagagctaaacgaacagctgatcaacaagtg
aaagaattggagagtttgcttaaagcagctgatgtaaaacctccttatttggctgtttca
cactcatacggagctgtcatcaccggtttatgggcctgcaaaaacaagcatgatattatc
ggcatggtccttcttgacccagctttaggcgattgcgccagctttacctttatacccgaa
gaaatgcacaaatcacatacgagaaagatgatgcttgagggcacacatgcagagttttca
aaaagtctgcaggagctcaaaaagcggcaagtccacttaggaaacatgcctcttcttgtg
ttgtcatcaggagaacggactgagaaattcgctgctgaacaggagtggcaaaacttgcac
agcagcatattgtctctatctaaccaaagcggctggattcaagctaaaaacagctcccac
aacatccatcatgatgaacctcatatcgttcacttggctatttatgacgtatggtgcgca
gcgtgccagcaggccgctcctctttaccaggcagtcaattaa

DBGET integrated database retrieval system