KEGG   Bacillus subtilis subsp. subtilis 168: BSU23840
Entry
BSU23840          CDS       T00010                                 
Symbol
yqjK
Name
(RefSeq) ribonuclease Z
  KO
K00784  ribonuclease Z [EC:3.1.26.11]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU23840 (yqjK)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.11  tRNase Z
     BSU23840 (yqjK)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  3'processing and CCA adding factors
   3'processing factors
    BSU23840 (yqjK)
 Prokaryotic type
    BSU23840 (yqjK)
SSDB
Motif
Pfam: Lactamase_B_2 Lactamase_B Lactamase_B_4 PDEase_II
Other DBs
NCBI-GeneID: 938694
NCBI-ProteinID: NP_390265
Pasteur: BG11740
BSORF: BG11740
UniProt: P54548 A0A6M4JLJ9
Structure
Position
complement(2478006..2478929)
AA seq 307 aa
MELLFLGTGAGIPAKARNVTSVALKLLEERRSVWLFDCGEATQHQILHTTIKPRKIEKIF
ITHMHGDHVYGLPGLLGSRSFQGGEDELTVYGPKGIKAFIETSLAVTKTHLTYPLAIQEI
EEGIVFEDDQFIVTAVSVIHGVEAFGYRVQEKDVPGSLKADVLKEMNIPPGPVYQKIKKG
ETVTLEDGRIINGNDFLEPPKKGRSVVFSGDTRVSDKLKELARDCDVLVHEATFAKEDRK
LAYDYYHSTTEQAAVTAKEARAKQLILTHISARYQGDASLELQKEAVDVFPNSVAAYDFL
EVNVPRG
NT seq 924 nt   +upstreamnt  +downstreamnt
gtggaattactttttttagggacgggagccggcatccccgccaaggcgagaaatgtaacg
tcggtggcattaaaattgcttgaagaaaggcgttcggtatggctttttgactgcggggaa
gccacacagcatcaaattttacatacaacgattaaacctcgtaaaatagagaaaatcttt
attacacacatgcacggcgatcatgtatacggacttccggggcttctggggagccgttcc
tttcaaggcggagaggacgagctgacagtgtacggacctaaagggatcaaggcgtttatt
gaaacaagccttgccgtcacgaaaacccatttgacatatccgcttgcgatccaggaaatt
gaagaaggaatcgtgtttgaggacgatcagtttattgtcacagcggtatctgttattcat
ggagtggaagccttcgggtaccgtgtgcaggaaaaagacgtaccgggttccttgaaggct
gacgtattaaaagaaatgaacatcccgcccggacctgtatatcagaaaatcaaaaaaggc
gaaacggtaacgcttgaagacggacgaatcatcaatgggaatgattttctggagcctcct
aaaaagggaagatctgttgtgttctccggtgatacgagagtaagtgacaaactaaaagag
cttgcgagggattgtgatgtgcttgttcatgaagcaacctttgctaaggaagaccgtaaa
cttgcttatgattattatcacagtacaacggaacaagcggctgtaacagcgaaagaagca
agagcgaagcagctcattttaacccatatcagcgcaagatatcagggagatgcttctttg
gagcttcaaaaagaagcggttgacgttttccccaatagcgtggcggcatatgatttctta
gaggtaaacgtcccgcgaggctga

DBGET integrated database retrieval system