KEGG   Bacillus subtilis subsp. subtilis 168: BSU23860
Entry
BSU23860          CDS       T00010                                 

Symbol
yqjI
Name
(RefSeq) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu00480  Glutathione metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Module
bsu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bsu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU23860 (yqjI)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSU23860 (yqjI)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     BSU23860 (yqjI)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     BSU23860 (yqjI)
SSDB
Motif
Pfam: 6PGD NAD_binding_2 Shikimate_DH 2-Hacid_dh_C F420_oxidored 3HCDH_N IlvN
Other DBs
NCBI-GeneID: 938695
NCBI-ProteinID: NP_390267
Pasteur: BG11738
BSORF: BG11738
UniProt: P80859 A0A6M3ZDL7
Position
complement(2480750..2482159)
AA seq 469 aa
MSKQQIGVIGLAVMGKNLALNIESRGFSVSVYNRSSSKTEEFLQEAKGKNVVGTYSIEEF
VQSLETPRKILLMVKAGTATDATIQSLLPHLEKDDILIDGGNTYYKDTQRRNKELAESGI
HFIGTGVSGGEEGALKGPSIMPGGQKEAHELVKPILEAISAKVDGEPCTTYIGPDGAGHY
VKMVHNGIEYGDMQLISESYFILKQVLGLSADELHEVFAEWNKGELDSYLIEITADIFTK
KDEETGKPLVDVILDKAGQKGTGKWTSQSALDLGVPLPIITESVFARFISAMKEERVKAS
GLLSGPEVKPVTENKEELIEAVRKALFMSKICSYAQGFAQMKAASEEYNWDLKYGEIAMI
FRGGCIIRAAFLQKIKEAYDREPELDNLLLDSYFKNIVESYQGALRQVISLAVAQGVPVP
SFSSALAYYDSYRTAVLPANLIQAQRDYFGAHTYERTDKEGIFHTEWMK
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgtcaaaacaacaaatcggcgttatcggacttgcggtcatgggtaaaaatctggcttta
aatatcgaaagccggggattttctgtttctgtttacaacagatcaagcagtaaaactgag
gagtttttacaggaggcaaaaggaaaaaatgttgttggcacttacagcattgaagaattt
gtccaatccttggaaacaccgcgcaaaatcttattaatggttaaagcgggaactgcaaca
gatgcgacaattcaatctcttcttcctcatctagagaaggatgatattttaattgacggc
ggtaatacatactataaagatacacagcgccgtaacaaagaactcgctgaaagcggcatt
cattttatcggaacaggcgtttccggcggagaagaaggagcgcttaaaggaccttctatc
atgcctggcggacaaaaagaagcacatgagcttgtaaaaccgattcttgaagccatttct
gcaaaagttgacggagaaccttgtacgacatatatcggtccggacggcgccggccattac
gtaaaaatggtgcacaacggaattgaatacggagatatgcagctgatctctgaatcatat
ttcattctgaaacaggtgctgggcctttctgctgatgagcttcatgaagttttcgctgaa
tggaataaaggtgagcttgatagctacctgattgagattacggctgacatcttcacaaaa
aaagacgaagaaacaggcaaaccgcttgttgatgtgattcttgataaagcaggccaaaaa
ggaacaggaaaatggacaagccaaagcgcacttgacttaggcgttccgcttccgattatt
actgaatctgtattcgcacgctttatctcagctatgaaggaagagcgtgtaaaagcgagc
ggacttctttcaggaccagaagtgaagcctgttacagaaaataaagaagagctgattgaa
gcggtcagaaaagcgttgttcatgagtaaaatctgttcatacgcgcaaggatttgcccaa
atgaaagctgcttctgaagaatacaactgggatctgaaatatggtgaaatcgctatgatc
ttccgcggtggttgcatcattcgcgcggcattccttcagaagatcaaagaagcttacgat
cgcgagcctgagcttgacaacctgcttcttgacagctatttcaagaatattgtagaaagc
tatcaaggagcgcttcgccaagtgatttcacttgcagttgcccaaggtgtgccggtgcca
tcattctcaagcgcattagcctactatgacagctaccgcacagccgtactgcctgcaaac
ttaatccaagcacagcgcgactactttggcgctcatacttatgagcgtactgacaaagaa
ggcatcttccatactgaatggatgaagtaa

DBGET integrated database retrieval system