KEGG   Bacillus subtilis subsp. subtilis 168: BSU23870
Entry
BSU23870          CDS       T00010                                 

Symbol
yqjH
Name
(RefSeq) DNA polymerase IV 1
  KO
K02346  DNA polymerase IV [EC:2.7.7.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU23870 (yqjH)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BSU23870 (yqjH)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    BSU23870 (yqjH)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH HHH_5 Cdd1 DNA_pol_lambd_f
Other DBs
NCBI-GeneID: 938691
NCBI-ProteinID: NP_390268
Pasteur: BG11737
BSORF: BG11737
UniProt: P54545 A0A6M3ZGZ9
Position
complement(2482269..2483513)
AA seq 414 aa
MPGKSRIIFHIDMNSFYASVEMAYDPALRGKPVAVAGNVKERKGIVVTCSYEARARGVKT
TMPVWQAKRHCPELIVLPPNFDRYRNSSRAMFTILREYTDLVEPVSIDEGYMDMTDTPYS
SRALETAKEIQSRLQKELLLPSSIGIAPNKFLAKMASDMKKPLGITILRKRQVPDILWPL
PVGEMHGVGKKTAEKLKGLGIHTIGELAAADEHSLKRLLGINGPRLKNKANGIHHAPVDP
ERIYEFKSVGNSSTLSHDSSDEEELLGVFRKLAASVSDRLQRKEVMASKLFIMIRYADWR
TITRSTTLRNPIDQKNDILKEAEHLFFKHWNKNPVRLLGITGTDLVEKEQAYKQLDLFSF
NEDAKDEPIQQMMEKLNKKYGTKLIRKGATLKKEESKTKGTSFNKDFFQDEKKS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgccgggaaagagccgaattattttccatattgatatgaatagcttttatgcgtcggtt
gaaatggcatatgatccggctctccggggaaagccggtcgcagttgccggaaacgtaaag
gagcgaaagggcattgtggtaacatgcagctacgaagcaagagcgcgcggcgtcaaaaca
acgatgccggtttggcaagcgaagcgccattgtcctgagctcatcgttcttccgccgaac
tttgaccgctatagaaactcttcacgagcgatgtttaccattcttcgtgaatatactgac
ctagtggagcctgtctccatcgacgaaggctatatggacatgaccgatacaccatacagc
agccgcgctctagagacggcaaaagaaatccaaagcaggctgcaaaaagagctgctgctc
ccgtcaagcatagggattgcaccgaataaatttctcgctaagatggcgtctgatatgaaa
aaaccgcttggaattacgatcttaagaaagaggcaagtgcccgatatcctgtggccgctt
cctgttggagagatgcacggagtcggcaaaaagacagcggaaaaactgaagggactcggc
atccatacaatcggagagctagctgcagctgatgaacactcgctgaagcgcctgcttggc
atcaacggtccgcgccttaaaaataaagcaaatggcattcaccatgcgccggttgacccg
gagcgcatttacgaatttaaaagcgtcggcaactcatcgacactttcccatgattccagt
gatgaagaagagctgttaggcgtttttagaaagcttgccgcttctgtgagtgaccgttta
cagcgcaaggaagtcatggcttcgaagctttttattatgattagatatgcggattggaga
accatcacaagaagcactacgctgagaaacccgattgatcaaaaaaatgacattttgaaa
gaagcggagcacctcttttttaaacattggaataaaaatcctgtcaggctgcttggcatt
accggaacggatttagtagaaaaagagcaggcctataaacagctcgatttgttcagcttt
aatgaagatgcgaaggatgagcccattcagcagatgatggaaaagctgaataaaaagtac
ggtaccaaactgatcagaaaaggggcaacgttaaaaaaagaggagagcaaaacaaaggga
acaagctttaataaagatttttttcaagatgaaaagaaaagctga

DBGET integrated database retrieval system