KEGG   Bacillus subtilis subsp. subtilis 168: BSU23880
Entry
BSU23880          CDS       T00010                                 

Gene name
yqzJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PqiA
Other DBs
NCBI-GeneID: 2914225
NCBI-ProteinID: YP_054586
Pasteur: BG14191
BSORF: BG14191
UniProt: Q7WY64 A0A6M3ZKX6
Position
2483586..2483873
AA seq 95 aa
MTMFVESINDVLFLVDFFTIILPALTAIGIAFLLRECRAGEQWKSKRTDEHQTVFHINRT
DFLIIIYHRITTWIRKVFRMNSPVNDEEDAGSLLL
NT seq 288 nt   +upstreamnt  +downstreamnt
atgacaatgtttgtggaatcgataaatgacgttttattcttagtcgattttttcacaatt
attcttcctgctctaacggcaatcgggattgcattcctcttacgggagtgccgtgcgggc
gagcaatggaaatcaaaacgaacagatgaacatcagacggtctttcacattaaccgaaca
gactttcttattattatatatcatcgcattacaacttggatacgtaaagtcttccgcatg
aattcgcctgtgaacgatgaggaagacgccggttctcttcttttataa

DBGET integrated database retrieval system