KEGG   Bacillus subtilis subsp. subtilis 168: BSU23900
Entry
BSU23900          CDS       T00010                                 

Gene name
yqjF
Definition
(RefSeq) hypothetical protein
  KO
K09166  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU23900 (yqjF)
SSDB
Motif
Pfam: DUF2071 ADC
Other DBs
NCBI-GeneID: 938688
NCBI-ProteinID: NP_390270
Pasteur: BG11735
BSORF: BG11735
UniProt: P54543
Position
2484911..2485639
AA seq 242 aa
MTERFQQKNISVPDGIWIMRQTWNDVLFAHWPVDVSILRALVPSVLELDTYNGQAWISML
PFMLTNLRARYLPVIPGARAFPELNLRTYVTYKGKPGIYFFSLDADHRLAVLGARTFFHL
PYFYADMKSEKNGDAIDYVSKRKNDKEAAFHAAYRPISAPFTAEKDSLDYWLTERYRLYT
TYRNKLYYEDIHHHPWLLQNAEAEISVNTVTDAHGITLPESDPLLHYAKKQDVLFWPLRK
WS
NT seq 729 nt   +upstreamnt  +downstreamnt
ttgacggaacgctttcagcaaaaaaatatttctgtacctgatggaatctggatcatgaga
caaacctggaatgatgtcttatttgctcactggcctgttgatgtttctatccttcgcgct
ttggtaccgtccgttttagaattagatacatataacgggcaagcttggatcagcatgctt
ccctttatgctcacgaacctgagggcgcgttatctccctgtcattcccggtgcgcgtgca
tttcctgagcttaacctccgcacctatgtcacgtataaaggcaagcccggcatttatttt
tttagcttagatgccgatcatcgtctggcggtccttggcgctcgcacattctttcatctg
ccttatttttacgcggatatgaagtccgaaaaaaacggtgatgccattgactatgtcagc
aagcggaaaaatgacaaagaagcagcattccacgccgcataccggccaatttcagcgcct
tttacagcagaaaaggattcgctcgattactggctgacagaacgatacaggctctacacc
acttatcgcaataagctctattacgaagacatccatcatcatccgtggctgctgcaaaac
gccgaagcagaaatttcagtcaatacggtgactgatgctcacggtattacattgccggag
tcagaccccttgcttcattatgctaaaaaacaggatgtgttattttggccgcttaggaaa
tggagctaa

DBGET integrated database retrieval system