KEGG   Bacillus subtilis subsp. subtilis 168: BSU23910
Entry
BSU23910          CDS       T00010                                 

Symbol
yqjE
Name
(RefSeq) hypothetical protein
  KO
K01258  tripeptide aminopeptidase [EC:3.4.11.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU23910 (yqjE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.4  tripeptide aminopeptidase
     BSU23910 (yqjE)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M20
   BSU23910 (yqjE)
SSDB
Motif
Pfam: Peptidase_M20 Peptidase_M42 M20_dimer Peptidase_M28 DUF3825
Other DBs
NCBI-GeneID: 938687
NCBI-ProteinID: NP_390271
Pasteur: BG11734
BSORF: BG11734
UniProt: P54542 A0A6M3ZIV7
Position
complement(2485680..2486795)
AA seq 371 aa
MVNEKRLLEEFLELVQIDSETKHEAEICKVLKRKFSDLGVDVKEDDTMDITGHGAGNLIC
TLKGTKQTDTIYFTSHMDTVVPGNGVKPVVENGYVKTDGTTILGADDKAGLAAMFEAIKV
LKEENIEHGTIEFIITVGEESGLIGAKALDRSMITASYGYALDSDGKVGNIIVAAPTQAK
VRAAIFGKTAHAGVEPEKGISAITIASKAISKMPLGRIDEETTANIGRFEGGTQTNIVCD
EVHILAEARSLVPEKMEAQVQKMKAAFEEAAADMGGRAEVEIEVMYPGFKYQDGDQVVEI
AKKAAAKIGRPSELQTSGGGSDANVIAGHGIPTVNLAVGYEQIHTKNEKMPIEELVKTAE
MVVAIIEEAAK
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggtgaatgaaaaacgcctgctggaagaatttttagagcttgtccaaattgactcagaa
acaaagcacgaagctgaaatctgcaaagtgctgaaacgaaaattttctgatttaggtgtg
gacgttaaagaagacgatacaatggatatcacgggccacggagccggtaacctgatttgc
acgctaaaagggacaaaacaaacagatacgatctattttacatctcatatggacacagtt
gtacccggaaacggcgtaaaaccagttgtagagaacggttacgtcaaaactgacggcacg
acgattttaggtgctgatgataaagcgggattggctgcaatgtttgaggcgattaaggtg
ctgaaagaagaaaatattgaacacggcacgattgaattcatcatcacagtaggggaagaa
tcgggtctgatcggagcgaaggcgcttgaccgttctatgatcactgcatcctacggctat
gctcttgattcagacggaaaagtcggaaatatcattgtggccgcgccgacacaggcgaag
gtaagagcggcaattttcgggaaaaccgctcacgccggggttgaacctgaaaaaggcatt
tcagcgattacaatcgctagcaaagccatctcaaaaatgccattgggccgtatcgatgaa
gaaacaacagctaatatcggccggtttgaaggcggcacacaaacaaacattgtgtgcgac
gaagttcatattcttgctgaagcgcgctctttagttcctgagaaaatggaagctcaggtt
caaaaaatgaaagctgcttttgaagaggcagctgctgatatgggcggacgcgcagaagtc
gaaattgaggttatgtatccgggctttaaatatcaagacggcgaccaagttgttgaaatc
gcgaaaaaagcggctgctaaaatcggacgtccaagcgagctgcaaacgagcggcggcgga
agcgacgcgaacgtaatcgctggtcatggcatcccgacggtcaatcttgctgtcggttat
gagcaaatccatacaaaaaatgaaaaaatgccgatcgaagagctcgttaaaacggcagaa
atggttgttgccattattgaagaggcggcaaaataa

DBGET integrated database retrieval system